Inward rectifier potassium channel 16 (KCNJ16) Recombinant Protein | KCNJ16 recombinant protein

Recombinant Human Inward rectifier potassium channel 16 (KCNJ16)

Cat. Num. AAA7017687

• Gene Names: KCNJ16; BIR9; KIR5.1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Inward rectifier potassium channel 16 (KCNJ16); Recombinant Human Inward rectifier potassium channel 16 (KCNJ16); KCNJ16 recombinant protein

• Host: Cell Free Expression
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 1-418aa; full length protein
• Sequence: MSYYGSSYHIINADAKYPGYPPEHIIAEKRRARRRLLHKDGSCNVYFKHIFGEWGSYVVD IFTTLVDTKWRHMFVIFSLSYILSWLIFGSVFWLIAFHHGDLLNDPDITPCVDNVHSFTG AFLFSLETQTTIGYGYRCVTEECSVAVLMVILQSILSCIINTFIIGAALAKMATARKRAQ TIRFSYFALIGMRDGKLCLMWRIGDFRPNHVVEGTVRAQLLRYTEDSEGRMTMAFKDLKL VNDQIILVTPVTIVHEIDHESPLYALDRKAVAKDNFEILVTFIYTGDSTGTSHQSRSSYV PREILWGHRFNDVLEVKRKYYKVNCLQFEGSVEVYAPFCSAKQLDWKDQQLHIEKAPPVR ESCTSDTKARRRSFSAVAIVSSCENPEETTTSATHEYRETPYQKALLTLNRISVESQM
• Sequence Length: Full length protein

• Application Notes: This is a recombinant transmembrane protein expressed in a cell-free expression system.
• Species: Human
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Product Categories/Family for KCNJ16 recombinant protein

Transmembrane Protein

NCBI and Uniprot Product Information

• NCBI GI #: 394025751
• NCBI GeneID: 3773
• NCBI Accession #: NP_001257351.1
• NCBI GenBank Nucleotide #: NM_001270422.1
• UniProt Accession #: Q9NPI9
• Molecular Weight: 47,949 Da
• NCBI Official Full Name: inward rectifier potassium channel 16 isoform b
• NCBI Official Synonym Full Names: potassium voltage-gated channel subfamily J member 16
• NCBI Official Symbol: KCNJ16
• NCBI Official Synonym Symbols: BIR9; KIR5.1
• NCBI Protein Information: inward rectifier potassium channel 16
• UniProt Protein Name: Inward rectifier potassium channel 16
• Protein Family: Inward rectifier potassium channel
• UniProt Gene Name: KCNJ16
• UniProt Entry Name: KCJ16_HUMAN

NCBI Description

Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein, which tends to allow potassium to flow into rather than out of a cell, can form heterodimers with two other inward-rectifier type potassium channels. It may function in fluid and pH balance regulation. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Apr 2014]

Uniprot Description

Kir5.1: Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. KCNJ16 may be involved in the regulation of fluid and pH balance. Belongs to the inward rectifier-type potassium channel (TC 1.A.2.1) family. KCNJ16 subfamily.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 17q24.3

Cellular Component: basolateral plasma membrane; integral to plasma membrane; plasma membrane; voltage-gated potassium channel complex

Molecular Function: G-protein activated inward rectifier potassium channel activity; inward rectifier potassium channel activity

Biological Process: potassium ion import; potassium ion transport