Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ATP-sensitive inward rectifier potassium channel 12 (Kcnj12) Recombinant Protein | Kcnj12 recombinant protein

Recombinant Rat ATP-sensitive inward rectifier potassium channel 12 (Kcnj12)

Gene Names
Kcnj12; IRK2; Kir2.1; Kir2.2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ATP-sensitive inward rectifier potassium channel 12 (Kcnj12); Recombinant Rat ATP-sensitive inward rectifier potassium channel 12 (Kcnj12); Recombinant ATP-sensitive inward rectifier potassium channel 12 (Kcnj12); ATP-sensitive inward rectifier potassium channel 12; Inward rectifier K(+) channel Kir2.2; IRK-2 Potassium channel; inwardly rectifying subfamily J member 12; Kcnj12 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-427
Sequence
MTAASRANPYSIVSSEEDGLHLVTMSGANGFGNGKVHTRRRCRNRFVKKNGQCNIEFANMDEKSQRYLADMFTTCVDIRWRYMLLIFSLAFLASWLLFGIIFWVIAVAHGDLEPAEGRGRTPCVLQVHGFMAAFLFSIETQTTIGYGLRCVTEECPVAVFMVVAQSIVGCIIDSFMIGAIMAKMGRPKKRAQTLLFSHNAVVALRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRVTEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEIDEASPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLANEILWGHRFEPVLFEEKNQYKIDYSHFHKTYEVPSTPRCSAKDLVENKFLLPSANSFCYENELAFLSRDEEDEVATDRDGRSPQPEHDFDRLQASSGALERPYRRESEI
Sequence Length
427
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
48,399 Da
NCBI Official Full Name
ATP-sensitive inward rectifier potassium channel 12
NCBI Official Synonym Full Names
potassium inwardly-rectifying channel, subfamily J, member 12
NCBI Official Symbol
Kcnj12
NCBI Official Synonym Symbols
IRK2; Kir2.1; Kir2.2
NCBI Protein Information
ATP-sensitive inward rectifier potassium channel 12; IRK-2; inward rectifier K(+) channel Kir2.2; potassium channel, inwardly rectifying subfamily J member 12
UniProt Protein Name
ATP-sensitive inward rectifier potassium channel 12
UniProt Gene Name
Kcnj12
UniProt Synonym Gene Names
Irk2; IRK-2
UniProt Entry Name
IRK12_RAT

NCBI Description

inward rectifier potassium channel [RGD, Feb 2006]

Uniprot Description

KCNJ12: Probably participates in establishing action potential waveform and excitability of neuronal and muscle tissues. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium and cesium. Belongs to the inward rectifier-type potassium channel (TC 1.A.2.1) family. KCNJ12 subfamily.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Cellular Component: cell soma; integral to plasma membrane; dendrite; T-tubule; integral to membrane; intrinsic to membrane

Molecular Function: protein binding; inward rectifier potassium channel activity; PDZ domain binding

Biological Process: potassium ion import; potassium ion transport; protein homotetramerization

Research Articles on Kcnj12

Similar Products

Product Notes

The Kcnj12 kcnj12 (Catalog #AAA955457) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-427. The amino acid sequence is listed below: MTAASRANPY SIVSSEEDGL HLVTMSGANG FGNGKVHTRR RCRNRFVKKN GQCNIEFANM DEKSQRYLAD MFTTCVDIRW RYMLLIFSLA FLASWLLFGI IFWVIAVAHG DLEPAEGRGR TPCVLQVHGF MAAFLFSIET QTTIGYGLRC VTEECPVAVF MVVAQSIVGC IIDSFMIGAI MAKMGRPKKR AQTLLFSHNA VVALRDGKLC LMWRVGNLRK SHIVEAHVRA QLIKPRVTEE GEYIPLDQID IDVGFDKGLD RIFLVSPITI LHEIDEASPL FGISRQDLET DDFEIVVILE GMVEATAMTT QARSSYLANE ILWGHRFEPV LFEEKNQYKI DYSHFHKTYE VPSTPRCSAK DLVENKFLLP SANSFCYENE LAFLSRDEED EVATDRDGRS PQPEHDFDRL QASSGALERP YRRESEI. It is sometimes possible for the material contained within the vial of "ATP-sensitive inward rectifier potassium channel 12 (Kcnj12), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.