ATP-sensitive inward rectifier potassium channel 10 (KCNJ10) Recombinant Protein | KCNJ10 recombinant protein

Recombinant Human ATP-sensitive inward rectifier potassium channel 10 (KCNJ10), partial

Cat. Num. AAA950015

• Gene Names: KCNJ10; KIR1.2; KIR4.1; SESAME; BIRK-10; KCNJ13-PEN
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: ATP-sensitive inward rectifier potassium channel 10 (KCNJ10); Recombinant Human ATP-sensitive inward rectifier potassium channel 10 (KCNJ10); partial; ATP-dependent inwardly rectifying potassium channel Kir4.1Inward rectifier K(+) channel Kir1.2; Potassium channel; inwardly rectifying subfamily J member 10; KCNJ10 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 165-379aa, Cytoplasmic Domain
• Sequence: FLAKIARPKKRAETIRFSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV

• Species: Homo sapiens (Human)
• Subcellular Location: Membrane, Multi-pass membrane protein, Basolateral cell membrane
• Protein Families: Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ10 subfamily
• Tissue Specificity: Expressed in kidney (at protein level).
• Relevance: May be responsible for potassium buffering action of glial cells in the brain. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of Extracellular domain potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by Extracellular domain barium and cesium.
• Function: May be responsible for potassium buffering action of glial cells in the brain. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium and cesium (By similarity). In the kidney, together with KCNJ16, mediates basolateral K(+) recycling in distal tubules; this process is critical for Na(+) reabsorption at the tubules.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

Product Categories/Family for KCNJ10 recombinant protein

Transport

References

The DNA sequence and biological annotation of human chromosome 1.Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K., Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.Nature 441:315-321(2006)
https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=HGNC:6256
https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Hs&CID=408960
https://www.genome.jp/dbget-bin/www_bget?hsa:3766
https://string-db.org/network/9606.ENSP00000357068
https://www.omim.org/entry/602208602208602208

NCBI and Uniprot Product Information

• NCBI GI #: 25121966
• NCBI GeneID: 3766
• NCBI Accession #: NP_002232.2
• NCBI GenBank Nucleotide #: NM_002241.4
• UniProt Accession #: P78508; Q5VUT9; Q8N4I7; Q92808; A3KME7
• Molecular Weight: 42,508 Da
• NCBI Official Full Name: ATP-sensitive inward rectifier potassium channel 10
• NCBI Official Synonym Full Names: potassium voltage-gated channel subfamily J member 10
• NCBI Official Symbol: KCNJ10
• NCBI Official Synonym Symbols: KIR1.2; KIR4.1; SESAME; BIRK-10; KCNJ13-PEN
• NCBI Protein Information: ATP-sensitive inward rectifier potassium channel 10
• UniProt Protein Name: ATP-sensitive inward rectifier potassium channel 10
• Protein Family: ATP-sensitive inward rectifier potassium channel
• UniProt Gene Name: KCNJ10

NCBI Description

This gene encodes a member of the inward rectifier-type potassium channel family, characterized by having a greater tendency to allow potassium to flow into, rather than out of, a cell. The encoded protein may form a heterodimer with another potassium channel protein and may be responsible for the potassium buffering action of glial cells in the brain. Mutations in this gene have been associated with seizure susceptibility of common idiopathic generalized epilepsy syndromes. [provided by RefSeq, Jul 2008]

Uniprot Description

May be responsible for potassium buffering action of glial cells in the brain. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium and cesium (). In the kidney, together with KCNJ16, mediates basolateral K+ recycling in distal tubules; this process is critical for Na+ reabsorption at the tubules.