Potassium voltage-gated channel subfamily E member 2 (KCNE2) Recombinant Protein | KCNE2 recombinant protein
Recombinant Human Potassium voltage-gated channel subfamily E member 2 (KCNE2)
Gene Names
KCNE2; LQT5; LQT6; ATFB4; MIRP1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Potassium voltage-gated channel subfamily E member 2 (KCNE2); Recombinant Human Potassium voltage-gated channel subfamily E member 2 (KCNE2); Potassium voltage-gated channel subfamily E member 2(MinK-related peptide 1)(Minimum potassium ion channel-related peptide 1)(Potassium channel subunit beta MiRP1); KCNE2 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-123aa, Full Length
Sequence
MSTLSNFTQTLEDVFRRIFITYMDNWRQNTTAEQEALQAKVDAENFYYVILYLMVMIGMFSFIIVAILVSTVKSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFKMSP
Species
Homo sapiens (Human)
Relevance
Ancillary protein that assembles as a beta subunit with a voltage-gated potassium channel complex of pore-forming alpha subunits. Modulates the gating kinetics and enhances stability of the channel complex. Assembled with KCNB1 modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1. Associated with KCNH2/HERG is proposed to form the rapidly activating component of the delayed rectifying potassium current in heart (IKr). May associate with KCNQ2 and/or KCNQ3 and modulate the native M-type current. May associate with HCN1 and HCN2 and increase potassium current. Interacts with KCNQ1; forms a heterooligomer complex leading to currents with an apparently instantaneous activation, a rapid deactivation process and a linear current-voltage relationship and decreases the amplitude of the outward current (PubMed:11101505).
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for KCNE2 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for KCNE2 recombinant protein
References
"KCNE2 confers background current characteristics to the cardiac KCNQ1 potassium channel."Tinel N., Diochot S., Borsotto M., Lazdunski M., Barhanin J.EMBO J. 19:6326-6330(2000)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
14,472 Da
NCBI Official Full Name
potassium voltage-gated channel subfamily E member 2
NCBI Official Synonym Full Names
potassium voltage-gated channel, Isk-related family, member 2
NCBI Official Symbol
KCNE2
NCBI Official Synonym Symbols
LQT5; LQT6; ATFB4; MIRP1
NCBI Protein Information
potassium voltage-gated channel subfamily E member 2; minK-related peptide 1; minK-related peptide-1; potassium channel subunit, MiRP1; potassium channel subunit beta MiRP1; voltage-gated K+ channel subunit MIRP1; minimum potassium ion channel-related pep
UniProt Protein Name
Potassium voltage-gated channel subfamily E member 2
Protein Family
UniProt Gene Name
KCNE2
UniProt Entry Name
KCNE2_HUMAN
Similar Products
Product Notes
The KCNE2 kcne2 (Catalog #AAA9018458) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-123aa, Full Length. The amino acid sequence is listed below: MSTLSNFTQT LEDVFRRIFI TYMDNWRQNT TAEQEALQAK VDAENFYYVI LYLMVMIGMF SFIIVAILVS TVKSKRREHS NDPYHQYIVE DWQEKYKSQI LNLEESKATI HENIGAAGFK MSP. It is sometimes possible for the material contained within the vial of "Potassium voltage-gated channel subfamily E member 2 (KCNE2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
