Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Potassium voltage-gated channel subfamily E member 2 Recombinant Protein | Kcne2 recombinant protein

Potassium voltage-gated channel subfamily E member 2

Gene Names
Kcne2; Mirp1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Potassium voltage-gated channel subfamily E member 2; Kcne2 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-123aa; full length protein
Sequence
MTTLANLTQTLEDAFKKVFITYMDSWRRNTTAEQQALQARVDAENFYYVILYLMVMIGMFAFIVVAILVSTVKSKRREHSQDPYHQYIVEDWQQKYRSQILHLEDSKATIHENLGATGFTVSP
Sequence Length
Full Length Protein
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Kcne2 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for Kcne2 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14,356 Da
NCBI Official Full Name
potassium voltage-gated channel subfamily E member 2
NCBI Official Synonym Full Names
potassium voltage-gated channel subfamily E regulatory subunit 2
NCBI Official Symbol
Kcne2
NCBI Official Synonym Symbols
Mirp1
NCBI Protein Information
potassium voltage-gated channel subfamily E member 2
UniProt Protein Name
Potassium voltage-gated channel subfamily E member 2
UniProt Gene Name
Kcne2
UniProt Entry Name
KCNE2_RAT

NCBI Description

small integral membrane subunit which binds with HERG, a pore-forming protein, to alter its channel function [RGD, Feb 2006]

Uniprot Description

KCNE2: Ancillary protein that assembles as a beta subunit with a voltage-gated potassium channel complex of pore-forming alpha subunits. Modulates the gating kinetics and enhances stability of the channel complex. Associated with KCNH2/HERG is proposed to form the rapidly activating component of the delayed rectifying potassium current in heart (IKr). May associate with KCNQ2 and/or KCNQ3 and modulate the native M-type current. May associate with KCNQ1/KVLTQ1 and elicit a voltage-independent current. May associate with HCN1 and HCN2 and increase potassium current. Defects in KCNE2 are the cause of long QT syndrome type 6 (LQT6). Long QT syndromes are heart disorders characterized by a prolonged QT interval on the ECG and polymorphic ventricular arrhythmias. They cause syncope and sudden death in response to exercise or emotional stress. KCNE2 mutants form channels that open slowly and close rapidly, thereby diminishing potassium currents. Defects in KCNE2 are the cause of familial atrial fibrillation type 4 (ATFB4). Atrial fibrillation is a common disorder of cardiac rhythm that is hereditary in a small subgroup of patients. It is characterized by disorganized atrial electrical activity and ineffective atrial contraction promoting blood stasis in the atria and reduces ventricular filling. It can result in palpitations, syncope, thromboembolic stroke, and congestive heart failure. Belongs to the potassium channel KCNE family.

Protein type: Membrane protein, integral

Cellular Component: cell surface; integral to membrane; lysosome; membrane; plasma membrane; voltage-gated potassium channel complex

Molecular Function: cation channel activity; delayed rectifier potassium channel activity; inward rectifier potassium channel activity; potassium channel regulator activity; protein binding; protein homodimerization activity; voltage-gated potassium channel activity

Biological Process: aging; potassium ion import; tongue development

Research Articles on Kcne2

Similar Products

Product Notes

The Kcne2 kcne2 (Catalog #AAA7042978) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-123aa; full length protein. The amino acid sequence is listed below: MTTLANLTQT LEDAFKKVFI TYMDSWRRNT TAEQQALQAR VDAENFYYVI LYLMVMIGMF AFIVVAILVS TVKSKRREHS QDPYHQYIVE DWQQKYRSQI LHLEDSKATI HENLGATGFT VSP. It is sometimes possible for the material contained within the vial of "Potassium voltage-gated channel subfamily E member 2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.