SDS-PAGE
Brugia malayi Recombinant Protein | JTB recombinant protein
Recombinant Brugia malayi (Filarial nematode worm)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Brugia malayi; Recombinant Brugia malayi (Filarial nematode worm); Brugia malayi (Filarial nematode worm); JTB recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
31-105aa; Extracellular Domain
Sequence
EAPVREEKLSVSTSTSPCWLVEEFVVTEECAPCSNFQIKSTPECGSTGYMEKITCSPSKRNEFRSCRSALMERHL
Sequence Length
146
Species
Brugia malayi (Filarial nematode worm)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for JTB recombinant protein
Required for normal cytokinesis during mitosis. Plays a role in the regulation of cell proliferation. May be a component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly
Product Categories/Family for JTB recombinant protein
References
"JTB: a novel membrane protein gene at 1q21 rearranged in a jumping translocation."
Hatakeyama S., Osawa M., Omine M., Ishikawa F.
Oncogene 18:2085-2090(1999)
NCBI and Uniprot Product Information
Uniprot Description
Required for normal cytokinesis during mitosis. Plays a role in the regulation of cell proliferation. May be a component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly ().
Similar Products
Product Notes
The JTB jtb (Catalog #AAA969548) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 31-105aa; Extracellular Domain. The amino acid sequence is listed below: EAPVREEKLS VSTSTSPCWL VEEFVVTEEC APCSNFQIKS TPECGSTGYM EKITCSPSKR NEFRSCRSAL MERHL. It is sometimes possible for the material contained within the vial of "Brugia malayi, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
