Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Disintegrin jarastatin Recombinant Protein | JT recombinant protein

Recombinant Bothrops jararaca Disintegrin jarastatin

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Disintegrin jarastatin; Recombinant Bothrops jararaca Disintegrin jarastatin; JT recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
16-88, Full length protein
Sequence
EAGEECDCGTPGNPCCDAATCKLRPGAQCAEGLCCDQCRFMKEGTVCRRARGDDMDDYCNGISAGCPRNPFHA
Sequence Length
73
Species
Bothrops jararaca (Jararaca)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
9,323 Da
NCBI Official Full Name
Disintegrin jarastatin
UniProt Protein Name
Disintegrin jarastatin
Protein Family
UniProt Gene Name
JT
UniProt Synonym Gene Names
JT

Uniprot Description

Binds alpha-5/beta-1 (ITGAV/ITGB1), alpha-V/beta-3 (ITGAV/ITGB3) and alpha-M/beta-2 (ITGAM/ITGB2) integrins. Is a potent inhibitor of platelet aggregation induced by ADP, collagen, and thrombin. Induces neutrophil chemotaxis and inhibits the chemotaxis of human neutrophils toward fMLP, IL-8, and jarastatin itself. Directly activates an integrin-coupled signaling and modulate the MAPK pathway in different ways, leading the neutrophils to express different functional response. Jarastatin-treated neutrophils accumulates F-actin at the plasmalemma. Induces PTK2/FAK1 and phosphoinositide 3-kinase (PI3K) activation. Induces Erk-2 translocation to nucleus and a delay of the spontaneous apoptosis of neutrophils. Increases the IL-8 mRNA levels in neutrophils. When injected simultaneously with melanoma cells in mice, jarastatin, flavoridin (FL) and kistrin (KR), significantly reduce tumor lung colonization. Jarastatin inhibits B16F10 cell growth in vitro. When it interacts with melanoma cells, it induces actin cytoskeleton rearrangement, increasing actin polymerization and PTK2/FAK1 phosphorylation. Interferes with NF-kappaB translocation in melanoma cells.

Similar Products

Product Notes

The Disintegrin jarastatin jt (Catalog #AAA1360383) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 16-88, Full length protein. The amino acid sequence is listed below: EAGEECDCGT PGNPCCDAAT CKLRPGAQCA EGLCCDQCRF MKEGTVCRRA RGDDMDDYCN GISAGCPRNP FHA. It is sometimes possible for the material contained within the vial of "Disintegrin jarastatin, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.