Hematological and neurological expressed 1 protein (Hn1) Recombinant Protein | Hn1 recombinant protein
Recombinant Mouse Hematological and neurological expressed 1 protein (Hn1)
Gene Names
Jpt1; Hn1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Hematological and neurological expressed 1 protein (Hn1); Recombinant Mouse Hematological and neurological expressed 1 protein (Hn1); Hn1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-154, Full length protein
Sequence
MTTTTTFKGVDPNSRNSSRVLRPPGGGSNFSLGFDEPAEQPVRKNKMASNIFGTPEENPPSWAKSAGSKSSGGREDSESPGTQRSNSSEASSGDFLDLKGEGDMHENVDTDFQANLAQMEEKPVPAAPVPSPVAPAPVPSRRNPPGGKSSLVLG
Sequence Length
154
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16,081 Da
NCBI Official Full Name
jupiter microtubule associated homolog 1
NCBI Official Synonym Full Names
Jupiter microtubule associated homolog 1
NCBI Official Symbol
Jpt1
NCBI Official Synonym Symbols
Hn1
NCBI Protein Information
jupiter microtubule associated homolog 1
UniProt Protein Name
Jupiter microtubule associated homolog 1
Protein Family
UniProt Gene Name
JPT1
Uniprot Description
Modulates negatively AKT-mediated GSK3B signaling. Induces CTNNB1 'Ser-33' phosphorylation and degradation through the suppression of the inhibitory 'Ser-9' phosphorylation of GSK3B, which represses the function of the APC:CTNNB1:GSK3B complex and the interaction with CDH1/E-cadherin in adherent junctions (). Plays a role in the regulation of cell cycle and cell adhesion (PubMed:25450365). Has an inhibitory role on AR-signaling pathway through the induction of receptor proteosomal degradation ().
Research Articles on Hn1
Similar Products
Product Notes
The Hn1 jpt1 (Catalog #AAA964918) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-154, Full length protein. The amino acid sequence is listed below: MTTTTTFKGV DPNSRNSSRV LRPPGGGSNF SLGFDEPAEQ PVRKNKMASN IFGTPEENPP SWAKSAGSKS SGGREDSESP GTQRSNSSEA SSGDFLDLKG EGDMHENVDT DFQANLAQME EKPVPAAPVP SPVAPAPVPS RRNPPGGKSS LVLG. It is sometimes possible for the material contained within the vial of "Hematological and neurological expressed 1 protein (Hn1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
