Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE (12% SDS-PAGE)

JAK2 / Tyrosine-Protein Kinase JAK2 Recombinant Protein | JAK2 recombinant protein

Tyrosine-protein kinase JAK2

Gene Names
JAK2; JTK10; THCYT3
Applications
ELISA, Western Blot
Purity
>90%
Synonyms
JAK2 / Tyrosine-Protein Kinase JAK2; Tyrosine-protein kinase JAK2; Janus kinase 2; JAK-2; JAK2 recombinant protein
Ordering
Host
E. coli
Purity/Purification
>90%
Form/Format
50mM NaH2PO4, 500mM NaCl Buffer with 500mM Imidazole, 10% glycerol(PH8.0)
Concentration
1mg/mL (varies by lot)
Sequence
HLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG
Applicable Applications for JAK2 recombinant protein
ELISA, Western Blot (WB), Antibody Production (AP)
Organism
Homo sapiens(human)
Protein Accession
O60674 (891-1132aa)
Preparation and Storage
Store at -20°C. (Avoid repeated freezing and thawing.)

SDS-PAGE

(12% SDS-PAGE)

SDS-PAGE (12% SDS-PAGE)
Related Product Information for JAK2 recombinant protein
Recombinant protein with His-tag

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26.62KD
NCBI Official Full Name
tyrosine-protein kinase JAK2 isoform a
NCBI Official Synonym Full Names
Janus kinase 2
NCBI Official Symbol
JAK2
NCBI Official Synonym Symbols
JTK10; THCYT3
NCBI Protein Information
tyrosine-protein kinase JAK2
UniProt Protein Name
Tyrosine-protein kinase JAK2
Protein Family
UniProt Gene Name
JAK2
UniProt Synonym Gene Names
JAK-2
UniProt Entry Name
JAK2_HUMAN

NCBI Description

This gene product is a protein tyrosine kinase involved in a specific subset of cytokine receptor signaling pathways. It has been found to be constituitively associated with the prolactin receptor and is required for responses to gamma interferon. Mice that do not express an active protein for this gene exhibit embryonic lethality associated with the absence of definitive erythropoiesis. [provided by RefSeq, Jul 2008]

Uniprot Description

JAK2: a non-receptor tyrosine-kinase involved in a specific subset of cytokine receptor signaling pathways, including IL-3, -5 and GM-CSF. Interacts with IL23R, SKB1 and STAM2. It has been found to be constitutively associated with the prolactin receptor and is required for responses to gamma interferon. Mice that do not express an active protein for this gene exhibit embryonic lethality associated with the absence of definitive erythropoiesis. Fusion of Jak2 to TEL1 (ETV6) by t(9;12)(p24;p13) causes myeloproliferative disease in humans and mouse models. The Jak inhibitor AG490 inhibits constitutive Jak2 phosphorylation and causes apoptosis in cells from breast cancer and relapsing acute lymphoblastic leukemia. A single activating mutation is associated with several hematological malignancies. Inhibitor: AG490.

Protein type: Protein kinase, TK; Kinase, protein; Protein kinase, tyrosine (non-receptor); EC 2.7.10.2; Oncoprotein; TK group; JakA family

Chromosomal Location of Human Ortholog: 9p24

Cellular Component: nucleoplasm; extrinsic to internal side of plasma membrane; cytoskeleton; nuclear matrix; cytoplasm; caveola; nucleus; cytosol; lipid raft

Molecular Function: protein C-terminus binding; histone binding; non-membrane spanning protein tyrosine kinase activity; acetylcholine receptor binding; protein kinase binding; protein kinase activity; interleukin-12 receptor binding; protein binding; growth hormone receptor binding; peptide hormone receptor binding; insulin receptor substrate binding; protein-tyrosine kinase activity; heme binding; phosphoinositide 3-kinase binding; type 1 angiotensin receptor binding; SH2 domain binding; ATP binding; receptor binding

Biological Process: establishment and/or maintenance of chromatin architecture; positive regulation of nitric oxide biosynthetic process; activation of MAPKK activity; tyrosine phosphorylation of Stat3 protein; response to lipopolysaccharide; tyrosine phosphorylation of JAK2 protein; protein amino acid phosphorylation; enzyme linked receptor protein signaling pathway; positive regulation of tyrosine phosphorylation of Stat3 protein; regulation of apoptosis; response to antibiotic; elevation of cytosolic calcium ion concentration; tumor necrosis factor-mediated signaling pathway; erythrocyte differentiation; mesoderm development; negative regulation of neuron apoptosis; positive regulation of cell activation; positive regulation of DNA binding; positive regulation of protein import into nucleus, translocation; axon regeneration; positive regulation of insulin secretion; JAK-STAT cascade; positive regulation of tumor necrosis factor production; tyrosine phosphorylation of Stat5 protein; positive regulation of phosphoinositide 3-kinase cascade; tyrosine phosphorylation of STAT protein; positive regulation of peptidyl-tyrosine phosphorylation; response to hydroperoxide; mineralocorticoid receptor signaling pathway; tyrosine phosphorylation of Stat1 protein; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription factor activity; positive regulation of cell differentiation; positive regulation of nitric-oxide synthase biosynthetic process; positive regulation of phosphoprotein phosphatase activity; peptidyl-tyrosine phosphorylation; hormone-mediated signaling; negative regulation of heart contraction; apoptosis; protein amino acid autophosphorylation; platelet-derived growth factor receptor signaling pathway; signal transduction; host programmed cell death induced by symbiont; negative regulation of cell proliferation; actin filament polymerization; positive regulation of cell proliferation; cell differentiation; STAT protein nuclear translocation; caspase activation; cell migration; cytokine and chemokine mediated signaling pathway; negative regulation of DNA binding; regulation of cell proliferation; positive regulation of interleukin-1 beta production; G-protein coupled receptor protein signaling pathway; positive regulation of tyrosine phosphorylation of Stat5 protein; regulation of inflammatory response; innate immune response; negative regulation of cell-cell adhesion; cell motility; blood coagulation; induction of apoptosis by oxidative stress; positive regulation of cell migration; positive regulation of inflammatory response

Disease: Polycythemia Vera; Myelofibrosis; Budd-chiari Syndrome; Erythrocytosis, Familial, 1; Thrombocythemia 3

Research Articles on JAK2

Similar Products

Product Notes

The JAK2 jak2 (Catalog #AAA2903589) is a Recombinant Protein produced from E. coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's JAK2 / Tyrosine-Protein Kinase JAK2 can be used in a range of immunoassay formats including, but not limited to, ELISA, Western Blot (WB), Antibody Production (AP). Researchers should empirically determine the suitability of the JAK2 jak2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: HLRDFEREIE ILKSLQHDNI VKYKGVCYSA GRRNLKLIME YLPYGSLRDY LQKHKERIDH IKLLQYTSQI CKGMEYLGTK RYIHRDLATR NILVENENRV KIGDFGLTKV LPQDKEYYKV KEPGESPFWY APESLTESKF SVASDVWSFG VVLYELFTYI EKSKSPPAEF MRMIGNDKQG QMIVFHLIEL LKNNGRLPRP DGCPDEIYMI MTECWNNNVN QRPSFRDLAL RVDQIRDNMA G. It is sometimes possible for the material contained within the vial of "JAK2 / Tyrosine-Protein Kinase JAK2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.