Integrin alpha-11 (Itga11) Recombinant Protein | Itga11 recombinant protein
Recombinant Mouse Integrin alpha-11 (Itga11) , partial
Gene Names
Itga11; 4732459H24Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Integrin alpha-11 (Itga11); Recombinant Mouse Integrin alpha-11 (Itga11); partial; Itga11 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
164-345. Partial, provide the VWFA domain
Sequence
DIVIVLDGSNSIYPWVEVQHFLINILKKFYIGPGQIQVGIVQYGEDAVHEFHLNDYRSVKDVVEAASHIEQRGGTETRTAFGIEFARSEAFQKGGRKGAKKVMIVITDGESHDSPDLEKVIRQSEKDNVTRYAVAVLGYYNRRGINPETFLNEIKYIASDPDDKHFFNVTDEAALKDIVDAL
Sequence Length
345
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Itga11 recombinant protein
This gene encodes an alpha integrin. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This protein contains an I domain, is expressed in muscle tissue, dimerizes with beta 1 integrin in vitro, and appears to bind collagen in this form. Therefore, the protein may be involved in attaching muscle tissue to the extracellular matrix. Alternative transcriptional splice variants have been found for this gene, but their biological validity is not determined.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
133,012 Da
NCBI Official Full Name
Integrin alpha-11
NCBI Official Synonym Full Names
integrin alpha 11
NCBI Official Symbol
Itga11
NCBI Official Synonym Symbols
4732459H24Rik
NCBI Protein Information
integrin alpha-11
UniProt Protein Name
Integrin alpha-11
Protein Family
UniProt Gene Name
Itga11
Uniprot Description
Integrin alpha-11/beta-1 is a receptor for collagen.
Research Articles on Itga11
Similar Products
Product Notes
The Itga11 itga11 (Catalog #AAA966480) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 164-345. Partial, provide the VWFA domain. The amino acid sequence is listed below: DIVIVLDGSN SIYPWVEVQH FLINILKKFY IGPGQIQVGI VQYGEDAVHE FHLNDYRSVK DVVEAASHIE QRGGTETRTA FGIEFARSEA FQKGGRKGAK KVMIVITDGE SHDSPDLEKV IRQSEKDNVT RYAVAVLGYY NRRGINPETF LNEIKYIASD PDDKHFFNVT DEAALKDIVD AL . It is sometimes possible for the material contained within the vial of "Integrin alpha-11 (Itga11), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
