Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Iron-sulfur cluster assembly protein 3 (ISU3) Recombinant Protein | ISU3 recombinant protein

Recombinant Arabidopsis thaliana Iron-sulfur cluster assembly protein 3 (ISU3)

Gene Names
ISU3; ATISU3; ISCU-like 3; ISCU-LIKE 3; T24H24.11; T24H24_11
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Iron-sulfur cluster assembly protein 3 (ISU3); Recombinant Arabidopsis thaliana Iron-sulfur cluster assembly protein 3 (ISU3); ISU3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
50-171, Full length protein
Sequence
PNVGTGLVGAPQCGDVMKLQVKFDGSGQIIDAKFKTFGCGSAIAASSVATEWVKGKSVEEVLTIKNSQIAKHLSLPPVKLHCSMLAEDAIKAAIKNYKEKQDKANGETVETIDSTYLHGIGS
Sequence Length
122
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18,471 Da
NCBI Official Full Name
ISCU-like 3
NCBI Official Symbol
ISU3
NCBI Official Synonym Symbols
ATISU3; ISCU-like 3; ISCU-LIKE 3; T24H24.11; T24H24_11
NCBI Protein Information
ISCU-like 3
UniProt Protein Name
Iron-sulfur cluster assembly protein 3
UniProt Gene Name
ISU3
UniProt Synonym Gene Names
AtISU3; Protein ISCU-LIKE 3

NCBI Description

Encodes a mitochondrial protein similar to E.coli IscU. In bacteria, IscU is a scaffold protein accepting sulfur and iron to build a transient Fe-S cluster,which is subsequently transferred to a target apoprotein.

Uniprot Description

Scaffold protein for the de novo synthesis of iron-sulfur (Fe-S) clusters within mitochondria, which is required for maturation of both mitochondrial and cytoplasmic [2Fe-2S] and [4Fe-4S] proteins (PubMed:17417719). First, a [2Fe-2S] cluster is transiently assembled on the scaffold protein ISCU (ISU1, ISU2 or ISU3). In a second step, the cluster is released from ISCU, transferred to a glutaredoxin, followed by the formation of mitochondrial [2Fe-2S] proteins, the synthesis of [4Fe-4S] clusters and their target-specific insertion into the recipient apoproteins. Cluster assembly on ISCU depends on the function of the cysteine desulfurase complex NFS1-ISD11, which serves as the sulfur donor for cluster synthesis, the iron-binding protein frataxin as the putative iron donor, and the electron transfer chain comprised of ferredoxin reductase and ferredoxin, which receive their electrons from NADH ().

Similar Products

Product Notes

The ISU3 isu3 (Catalog #AAA1182222) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 50-171, Full length protein. The amino acid sequence is listed below: PNVGTGLVGA PQCGDVMKLQ VKFDGSGQII DAKFKTFGCG SAIAASSVAT EWVKGKSVEE VLTIKNSQIA KHLSLPPVKL HCSMLAEDAI KAAIKNYKEK QDKANGETVE TIDSTYLHGI GS. It is sometimes possible for the material contained within the vial of "Iron-sulfur cluster assembly protein 3 (ISU3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.