Anti-adapter protein iraP (iraP) Recombinant Protein | iraP recombinant protein
Recombinant Salmonella typhi Anti-adapter protein iraP (iraP)
Gene Names
STY0415; yaiB
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Anti-adapter protein iraP (iraP); Recombinant Salmonella typhi Anti-adapter protein iraP (iraP); iraP recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-86, Full length protein
Sequence
MKNLIAELLLKLAQKEEESKELVAQVEALEIIVTAMLRNMAQNEQEMLIRQVEGALEGVKPDASVPDHDTELLRQYVKKLLRHPRH
Sequence Length
86
Species
Salmonella typhi
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
9,883 Da
NCBI Official Full Name
anti-RssB factor
NCBI Official Symbol
STY0415
NCBI Official Synonym Symbols
yaiB
NCBI Protein Information
anti-RssB factor
UniProt Protein Name
Anti-adapter protein IraP
Protein Family
UniProt Gene Name
iraP
Uniprot Description
Inhibits RpoS proteolysis by regulating RssB activity, thereby increasing the stability of the sigma stress factor RpoS especially during phosphate and magnesium starvation, but also in stationary phase and during nitrogen starvation. Its effect on RpoS stability is due to its interaction with RssB, which probably blocks the interaction of RssB with RpoS, and the consequent delivery of the RssB-RpoS complex to the ClpXP protein degradation pathway.
Similar Products
Product Notes
The iraP irap (Catalog #AAA1291184) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-86, Full length protein. The amino acid sequence is listed below: MKNLIAELLL KLAQKEEESK ELVAQVEALE IIVTAMLRNM AQNEQEMLIR QVEGALEGVK PDASVPDHDT ELLRQYVKKL LRHPRH. It is sometimes possible for the material contained within the vial of "Anti-adapter protein iraP (iraP), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
