Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Intermediate capsid protein VP6 Recombinant Protein

Recombinant Rotavirus A Intermediate capsid protein VP6

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Intermediate capsid protein VP6; Recombinant Rotavirus A Intermediate capsid protein VP6; Recombinant Intermediate capsid protein VP6; Intermediate capsid protein VP6 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-397aa; full length protein
Sequence
MEVLYSLSKTLKDARDKIIEGTLYSNVSDLIQQFNQMIVTMNGNDFQTGGIGNLPIRNWT FDFGLLGTTLLNLDANYVETARTTIEYFIDFIDNVCMDEMARESQRNGVAPQSEALRKLA GIKFKRINFNNSSEYIENWNLQNRRQRTGFVFHKPNIFPYSASFTLNRSQPMHDNLMGTM WLNAGSEIQVAGFDYSCALNAPANIQQFEHIVQLRRALTTATITLLPDAERFSFPRVINS ADGATTWFFNPIILRPNNVEVEFLLNGQIINTYQARFGTIIARNFDTIRLSFQLMRPPNM TPAVNALFPQAQPFQYHATVGLTLRIESAVCESVLADANETLLANVTAVRQEYAIPVGPV FPPGMNWTELITNYSPSREDNLQRVFTVASIRSMLIK
Sequence Length
397
Species
Rotavirus A (isolate Human/United States/WI61/1983 G9-P1A[8]-I1-R1-C1-M1-A1-N1-T1-E1-H1) (RV-A)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

UniProt Accession #
Molecular Weight
44,983 Da
UniProt Protein Name
Intermediate capsid protein VP6
UniProt Entry Name
VP6_ROTWI

Uniprot Description

Function: Intermediate capsid protein that self assembles to form an icosahedral capsid with a T=13 symmetry, which consists of 230 trimers of VP6, with channels at each of its five-fold vertices. This capsid constitutes the middle concentric layer of the viral mature particle. The innermost VP2 capsid and the intermediate VP6 capsid remain intact following cell entry to protect the dsRNA from degradation and to prevent unfavorable antiviral responses in the host cell during all the replication cycle of the virus. Nacent transcripts are transcribed within the structural confines of this double-layered particle (DLP) and are extruded through the channels at the five-fold axes. VP6 is required for the transcription activity of the DLP

By similarity.

Subunit structure: Homotrimer. Interacts with VP2

By similarity.

Subcellular location: Virion. Note: Component of the intermediate capsid. Also found in spherical cytoplasmic structures, called virus factories, that appear early after infection and are the site of viral replication and packaging

By similarity.

Post-translational modification: The N-terminus is blocked

By similarity.

Miscellaneous: The zinc ion is not essential for either trimerization or transcription activity of the DLP. Zinc-depleted VP6 has an increased sensitivity to proteases

By similarity.

Sequence similarities: Belongs to the rotavirus VP6 family.

Similar Products

Product Notes

The Intermediate capsid protein VP6 (Catalog #AAA1080993) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-397aa; full length protein. The amino acid sequence is listed below: MEVLYSLSKT LKDARDKIIE GTLYSNVSDL IQQFNQMIVT MNGNDFQTGG IGNLPIRNWT FDFGLLGTTL LNLDANYVET ARTTIEYFID FIDNVCMDEM ARESQRNGVA PQSEALRKLA GIKFKRINFN NSSEYIENWN LQNRRQRTGF VFHKPNIFPY SASFTLNRSQ PMHDNLMGTM WLNAGSEIQV AGFDYSCALN APANIQQFEH IVQLRRALTT ATITLLPDAE RFSFPRVINS ADGATTWFFN PIILRPNNVE VEFLLNGQII NTYQARFGTI IARNFDTIRL SFQLMRPPNM TPAVNALFPQ AQPFQYHATV GLTLRIESAV CESVLADANE TLLANVTAVR QEYAIPVGPV FPPGMNWTEL ITNYSPSRED NLQRVFTVAS IRSMLIK. It is sometimes possible for the material contained within the vial of "Intermediate capsid protein VP6, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.