VEGFR-1/Flt-1 (D3)-His Active Protein | VEGFR-1 active protein

Human VEGFR-1/Flt-1 (D3)-His, soluble

Cat. Num. AAA692528

• Gene Names: FLT1; FLT; FLT-1; VEGFR1; VEGFR-1
• Purity: > 95% by SDS-PAGE & visualized by Coomassie stain
• Synonyms: VEGFR-1/Flt-1 (D3)-His; Human VEGFR-1/Flt-1 (D3)-His; soluble; soluble vascular endothelial growth factor receptor-1; soluble FLT1; soluble VEGFR-1; VEGFR-1 active protein

• Host: Insect Cells
• Purity/Purification: > 95% by SDS-PAGE & visualized by Coomassie stain
• Form/Format: Lyophilized
• Sequence: SKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSI TKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYI FISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDT LIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQT NTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRA SVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSVNTSV HIYDKAFITVKHRKQQVLETVAGKRSYRLHHHHHH
• Sequence Length: 687

• Species: Human
• Biological Activity: The activity of sVEGFR-1(D3) was determined by its ability to inhibit the VEGF-A-induced proliferation of HUVECs.
• Tag: His-Tag
• N-terminal Sequence: SGSKLKD
• Preparation and Storage: Samples are stable for greater than six months at -20 degree C to -70 degree C. Reconstituted sVEGFR-1(D3) should be stored in working aliquots at -70 degree C.

Related Product Information for VEGFR-1 active protein

Recombinant human soluble Vascular Endothelial Growth Factor Receptor-1 domain D1-3 (sVEGFR-1(D3)) is produced as a non-chimeric protein in a monomeric form. The soluble receptor protein contains only the first 3 extracellular domains, which contain all the information necessary for binding of VEGF. The receptor monomers have a mass of approximately 45 kDa containing 352 amino acid residues. Endothelial cells express three different vascular endothelial growth factor (VEGF) receptors, belonging to the family of receptor tyrosine kinases (RTKs). They are named VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1), VEGFR-3 (Flt-4). Their expression is almost exclusively restricted to endothelial cells, but VEGFR-1 can also be found on monocytes, dendritic cells and on trophoblast cells. The flt-1 gene was first described in 1990. The receptor contains seven immunoglobulin-like extracellular domains, a single transmembrane region and an intracellular splited tyrosine kinase domain. Compared to VEGFR-2 the Flt-1 receptor has a higher affinity for VEGF but a weaker signaling activity. VEGFR-1 thus leads not to proliferation of endothelial cells, but mediates signals for differentiation. Interestingly a naturally occuring soluble variant of VEGFR-1 (sVEGFR-1) was found in HUVE supernatants in 1996, which is generated by alternative splicing of the flt-1 mRNA. The biological functions of sVEGFR-1 still are not clear, but it seems to be an endogenous regulator of angiogenesis, binding VEGF with the same affinity as the full-length receptor.

NCBI and Uniprot Product Information

• NCBI GI #: 229892220
• NCBI GeneID: 2321
• NCBI Accession #: NP_001153392.1
• NCBI GenBank Nucleotide #: NM_001159920.1
• UniProt Accession #: P17948
• NCBI Official Full Name: vascular endothelial growth factor receptor 1 isoform 2
• NCBI Official Synonym Full Names: fms related tyrosine kinase 1
• NCBI Official Symbol: FLT1
• NCBI Official Synonym Symbols: FLT; FLT-1; VEGFR1; VEGFR-1
• NCBI Protein Information: vascular endothelial growth factor receptor 1

NCBI Description

This gene encodes a member of the vascular endothelial growth factor receptor (VEGFR) family. VEGFR family members are receptor tyrosine kinases (RTKs) which contain an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and a tyrosine kinase (TK) domain within the cytoplasmic domain. This protein binds to VEGFR-A, VEGFR-B and placental growth factor and plays an important role in angiogenesis and vasculogenesis. Expression of this receptor is found in vascular endothelial cells, placental trophoblast cells and peripheral blood monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Isoforms include a full-length transmembrane receptor isoform and shortened, soluble isoforms. The soluble isoforms are associated with the onset of pre-eclampsia.[provided by RefSeq, May 2009]