Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Amino terminal fragment of Mouse uPA Protein | PLAU protein

Amino terminal fragment of Mouse uPA

Gene Names
Plau; uPA; u-PA
Purity
>95% by SDS-PAGE analysis
Synonyms
Amino terminal fragment of Mouse uPA; PLAU protein
Ordering
For Research Use Only!
Host
Insect cell culture
Purity/Purification
>95% by SDS-PAGE analysis
Form/Format
Frozen liquid
Concentration
1.0 mg/ml (varies by lot)
Sequence
GSVLGAPDESNCGCQNGGVCVSYKYFSRIRRCSCPRKFQGEHCEIDASKTCYHGNGDSYRGKANTDTKGRPCLAWNAPAVLQKPYNAHRPDAISLGLGKHNYCRNPDNQKRPWCYVQIGLRQFVQECMVHDCSLSK
Sequence Length
433
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Buffer
0.1M Tris-HCl; 0.15M NaCl; pH 7.4
Extinction Coefficient
1.45
Preparation and Storage
Store at -70 degree C. Shelf Life: 3 years from delivery
Related Product Information for PLAU protein
Amino terminal fragment of mouse urokinase.
Product Categories/Family for PLAU protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18,500
NCBI Official Full Name
urokinase-type plasminogen activator
NCBI Official Synonym Full Names
plasminogen activator, urokinase
NCBI Official Symbol
Plau
NCBI Official Synonym Symbols
uPA; u-PA
NCBI Protein Information
urokinase-type plasminogen activator; U-plasminogen activator
UniProt Protein Name
Urokinase-type plasminogen activator
UniProt Gene Name
Plau
UniProt Synonym Gene Names
U-plasminogen activator; uPA
UniProt Entry Name
UROK_MOUSE

Uniprot Description

uPA: Specifically cleave the zymogen plasminogen to form the active enzyme plasmin. Defects in PLAU are the cause of Quebec platelet disorder (QPD). QPD is an autosomal dominant bleeding disorder due to a gain-of-function defect in fibrinolysis. Although affected individuals do not exhibit systemic fibrinolysis, they show delayed onset bleeding after challenge, such as surgery. The hallmark of the disorder is markedly increased PLAU levels within platelets, which causes intraplatelet plasmin generation and secondary degradation of alpha-granule proteins. Belongs to the peptidase S1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; EC 3.4.21.73; Secreted, signal peptide; Protease; Motility/polarity/chemotaxis

Cellular Component: extracellular space; cell surface; focal adhesion; membrane; extracellular region

Molecular Function: peptidase activity; hydrolase activity; serine-type peptidase activity; serine-type endopeptidase activity; catalytic activity

Biological Process: fibrinolysis; regulation of cell adhesion mediated by integrin; regulation of smooth muscle cell migration; wound healing; smooth muscle cell migration; positive regulation of cell proliferation; response to hypoxia; skeletal muscle regeneration; regulation of receptor activity; angiogenesis; proteolysis; positive regulation of smooth muscle cell migration; regulation of cell proliferation

Research Articles on PLAU

Similar Products

Product Notes

The PLAU plau (Catalog #AAA135647) is a Protein produced from Insect cell culture and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: GSVLGAPDES NCGCQNGGVC VSYKYFSRIR RCSCPRKFQG EHCEIDASKT CYHGNGDSYR GKANTDTKGR PCLAWNAPAV LQKPYNAHRP DAISLGLGKH NYCRNPDNQK RPWCYVQIGL RQFVQECMVH DCSLSK . It is sometimes possible for the material contained within the vial of "Amino terminal fragment of Mouse uPA, Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.