INO80 complex subunit B (Ino80b) Recombinant Protein | Ino80b recombinant protein
Recombinant Mouse INO80 complex subunit B (Ino80b)
Gene Names
Ino80b; Papa1; Znhit4; HMG1YL4; Hmga1l4; 2510009I23Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
INO80 complex subunit B (Ino80b); Recombinant Mouse INO80 complex subunit B (Ino80b); Ino80b recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-375, full length protein
Sequence
MSACVPTVSSPLPLQDPMSKLWRRGSTSGAMEAPEPGETLELSLAGAHGHGVHKKKHKKHKKKHKKKHHQEEEAGPTLQTPAKPQLKLKIKLGGQVLGTKSVPTFTVIPEGPRSPSPLMVVDNEEEPMEGVPLEQYRAWLDEDSNLSPSPLRDLPGDLEGQEEEEEQRWLDALEKGELDDNGDLKKEINERLLTARQRALLQKARSQPSPTLPLPVGGGCPAPALTEEMLLKREERARKRRLQAARRAEEHKNQTIERLTKTAAPSGRGGRGAARGERRGGRAAAPAPAPMVRYCSGAQGSTLSFPPGVPTPTAVAQRPAPSGPAPRCSVPGCPHPRRYACSRTGQALCSLQCYRINLQLRLGGPEGPGSPLLAT
Sequence Length
375
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
40,565 Da
NCBI Official Full Name
INO80 complex subunit B
NCBI Official Synonym Full Names
INO80 complex subunit B
NCBI Official Symbol
Ino80b
NCBI Official Synonym Symbols
Papa1; Znhit4; HMG1YL4; Hmga1l4; 2510009I23Rik
NCBI Protein Information
INO80 complex subunit B
UniProt Protein Name
INO80 complex subunit B
Protein Family
UniProt Gene Name
Ino80b
UniProt Synonym Gene Names
Hmga1l4; Papa1; Znhit4; PAPA-1
Uniprot Description
Proposed core component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair.
Research Articles on Ino80b
Similar Products
Product Notes
The Ino80b ino80b (Catalog #AAA1403453) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-375, full length protein. The amino acid sequence is listed below: MSACVPTVSS PLPLQDPMSK LWRRGSTSGA MEAPEPGETL ELSLAGAHGH GVHKKKHKKH KKKHKKKHHQ EEEAGPTLQT PAKPQLKLKI KLGGQVLGTK SVPTFTVIPE GPRSPSPLMV VDNEEEPMEG VPLEQYRAWL DEDSNLSPSP LRDLPGDLEG QEEEEEQRWL DALEKGELDD NGDLKKEINE RLLTARQRAL LQKARSQPSP TLPLPVGGGC PAPALTEEML LKREERARKR RLQAARRAEE HKNQTIERLT KTAAPSGRGG RGAARGERRG GRAAAPAPAP MVRYCSGAQG STLSFPPGVP TPTAVAQRPA PSGPAPRCSV PGCPHPRRYA CSRTGQALCS LQCYRINLQL RLGGPEGPGS PLLAT. It is sometimes possible for the material contained within the vial of "INO80 complex subunit B (Ino80b), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
