SDS-PAGE
Listeria monocytogenes serotype 4b (strain F2365) Internalin-A Recombinant Protein | inlA recombinant protein
Recombinant Listeria monocytogenes serotype 4b (strain F2365) Internalin-A
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Listeria monocytogenes serotype 4b (strain F2365) Internalin-A; Recombinant Listeria monocytogenes serotype 4b (strain F2365) Internalin-A; inlA recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
562-770aa; Partial
Sequence
QFSINSYTATFDNDGVTTSQTVDYQGLLQEPTAPTKEGYTFKGWYDAKTGGDKWDFATSKMPAKNITLYAQYSANSYTATFDVDGKTTTQAVDYQGLLKEPKTPTKAGYTFKGWYDEKTDGKKWDFATDKMPANDITLYAQFTKNPVAPPTTGGNTPPTTNNGGNTTPPSANIPGSNTSNTSTGNSASTTSTMNAYDPYNSKEASLPTT
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for inlA recombinant protein
Mediates the entry of Listeria monocytogenes into cells.
References
Whole genome comparisons of serotype 4b and 1/2a strains of the food-borne pathogen Listeria monocytogenes reveal new insights into the core genome components of this species.Nelson K.E., Fouts D.E., Mongodin E.F., Ravel J., DeBoy R.T., Kolonay J.F., Rasko D.A., Angiuoli S.V., Gill S.R., Paulsen I.T., Peterson J.D., White O., Nelson W.C., Nierman W.C., Beanan M.J., Brinkac L.M., Daugherty S.C., Dodson R.J., Durkin A.S., Madupu R., Haft D.H., Selengut J., Van Aken S.E., Khouri H.M., Fedorova N., Forberger H.A., Tran B., Kathariou S., Wonderling L.D., Uhlich G.A., Bayles D.O., Luchansky J.B., Fraser C.M.Nucleic Acids Res. 32:2386-2395(2004)
Identification and characterization of nucleotide sequence differences in three virulence-associated genes of Listeria monocytogenes strains representing clinically important serotypes.Vines A., Swaminathan B.Curr. Microbiol. 36:309-318(1998)
NCBI and Uniprot Product Information
NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24.5 kDa
NCBI Official Full Name
internalin-A
UniProt Protein Name
Internalin-A
Protein Family
UniProt Gene Name
inlA
UniProt Entry Name
INLA_LISMF
Uniprot Description
Mediates the entry of Listeria monocytogenes into cells.
Similar Products
Product Notes
The inlA inla (Catalog #AAA1309924) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 562-770aa; Partial. The amino acid sequence is listed below: QFSINSYTAT FDNDGVTTSQ TVDYQGLLQE PTAPTKEGYT FKGWYDAKTG GDKWDFATSK MPAKNITLYA QYSANSYTAT FDVDGKTTTQ AVDYQGLLKE PKTPTKAGYT FKGWYDEKTD GKKWDFATDK MPANDITLYA QFTKNPVAPP TTGGNTPPTT NNGGNTTPPS ANIPGSNTSN TSTGNSASTT STMNAYDPYN SKEASLPTT . It is sometimes possible for the material contained within the vial of "Listeria monocytogenes serotype 4b (strain F2365) Internalin-A, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
