Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Interleukin 7 (IL7) Recombinant Protein | IL7 recombinant protein

Recombinant Interleukin 7 (IL7)

Gene Names
Il7; Il-7; hlb368; A630026I06Rik
Applications
SDS-Page, Western Blot, ELISA, Immunoprecipitation
Purity
> 95%
Synonyms
Interleukin 7 (IL7); Recombinant Interleukin 7 (IL7); IL7 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
> 95%
Form/Format
Supplied as lyophilized form in PBS,pH7.4, containing 5% sucrose, 0.01% sarcosyl.
Sequence
The target protein is fused with N-terminal His-Tag, its sequence is listed below.
MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGS-ECHIK DKEGKAYESV LMISIDELDK MTGTDSNCPN NEPNFFRKHV CDDTKEAAFL NRAARKLKQF LKMNISEEFN VHLLTVSQGT QTLVNCTSKE EKNVKEQKKN DACFLKRLLR EIKTCWNKIL KGSI
Sequence Length
154
Applicable Applications for IL7 recombinant protein
SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP)
Organism
Mus musculus (Mouse)
Expression System
Prokaryotic expression
Residues
Glu26~Ile154 (Accession # P10168) with N-terminal His-Tag
Endotoxin Level
<1.0EU per 1ug (determined by the LAL method)
Reconstitution
Reconstitute in sterile PBS, pH7.2-pH7.4.
Preparation and Storage
Avoid repeated freeze/thaw cycles. Store at 2-8 degree C for one month. Aliquot and store at -80 degree C for 12 months.
Stability Test: The thermal stability is described by the loss rate of the targetprotein. The loss rate was determined by accelerated thermal degradation test,that is, incubate the protein at 37 degree C for 48h, and no obvious degradation andprecipitation were observed. (Referring from China Biological Products Standard,which was calculated by the Arrhenius equation.) The loss of this protein is lessthan 5% within the expiration date under appropriate storage condition.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18.4kDa
NCBI Official Full Name
interleukin-7
NCBI Official Synonym Full Names
interleukin 7
NCBI Official Symbol
Il7
NCBI Official Synonym Symbols
Il-7; hlb368; A630026I06Rik
NCBI Protein Information
interleukin-7
UniProt Protein Name
Interleukin-7
Protein Family
UniProt Gene Name
Il7
UniProt Synonym Gene Names
Il-7; IL-7
UniProt Entry Name
IL7_MOUSE

NCBI Description

The protein encoded by this gene is a hematopoietic growth factor important for B and T cell development. Alternative splicing results in several transcript variants encoding different isoforms. [provided by RefSeq, Sep 2015]

Uniprot Description

IL7: Hematopoietic growth factor capable of stimulating the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation. Belongs to the IL-7/IL-9 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Cell development/differentiation; Apoptosis; Cell cycle regulation; Secreted, signal peptide; Cytokine

Cellular Component: extracellular space; extracellular region

Molecular Function: interleukin-7 receptor binding; growth factor activity; hematopoietin/interferon-class (D200-domain) cytokine receptor binding; cytokine activity

Biological Process: organ morphogenesis; T cell lineage commitment; cell-cell signaling; positive regulation of T cell differentiation; homeostasis of number of cells within a tissue; regulation of gene expression; negative regulation of catalytic activity; positive regulation of B cell proliferation; immune response; positive regulation of organ growth; humoral immune response; bone resorption

Research Articles on IL7

Similar Products

Product Notes

The IL7 il7 (Catalog #AAA2010810) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Interleukin 7 (IL7) can be used in a range of immunoassay formats including, but not limited to, SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP). Researchers should empirically determine the suitability of the IL7 il7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: The target protein is fused with N-terminal His-Tag, its sequence is listed below. MGSSHHHHHH SSGLVPRGSH MASMTGGQQM GRGS-ECHIK DKEGKAYESV LMISIDELDK MTGTDSNCPN NEPNFFRKHV CDDTKEAAFL NRAARKLKQF LKMNISEEFN VHLLTVSQGT QTLVNCTSKE EKNVKEQKKN DACFLKRLLR EIKTCWNKIL KGSI. It is sometimes possible for the material contained within the vial of "Interleukin 7 (IL7), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.