CD132 recombinant protein

CD132 Recombinant Protein

Cat. Num. AAA3003890

• Gene Names: IL2RG; P64; CIDX; IMD4; CD132; SCIDX; IL-2RG; SCIDX1
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Synonyms: CD132; CD132 Recombinant Protein; CD132 recombinant protein

• Host: E Coli
• Purity/Purification: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Form/Format: PBS, 4M Urea, PH7.4
• Concentration: >=0.5mg/ml (varies by lot)
• Sequence: LNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEA

• Tag: His-tag in C-terminal
• Expression Vector: pet-22b(+)
• BP: 732
• Restriction Site: NdeI-XhoI
• Preparation and Storage: Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.

Testing Data

()

Related Product Information for CD132 recombinant protein

Background: The IL-2 receptor is a multicomponent complex consisting of three subunits, a, b and g, each of which is required for high affinity binding of IL-2. The a chain functions primarily in binding IL-2, whereas the b and g chains contribute to IL-2 binding and are essential to IL-2-induced activation of signaling pathways leading to T cell growth. Both IL-4R and IL-7R were initially described as single chain high affinity ligand binding cytokine receptors. However, it is now well established that the IL-2R g chain functions as a second subunit of the high affinity IL-4R and IL-7R receptors. Consequently, the originally described subunits of these latter receptors are now referredto as IL-4Ra and IL-7Ra respectively, while the common subunit is referred to as gc. Although the common g chain enhances ligand binding in these three cytokine receptors, it has no capacity to bind these ligands on its own.There is evidence that the gc chain is also a subunit of IL-13R.

NCBI and Uniprot Product Information

• NCBI GI #: 400048
• NCBI GeneID: 3561
• UniProt Accession #: P31785; Q5FC12
• Molecular Weight: 369
• NCBI Official Full Name: Cytokine receptor common subunit gamma
• NCBI Official Synonym Full Names: interleukin 2 receptor, gamma
• NCBI Official Symbol: IL2RG
• NCBI Official Synonym Symbols: P64; CIDX; IMD4; CD132; SCIDX; IL-2RG; SCIDX1
• NCBI Protein Information: cytokine receptor common subunit gamma; gammaC; CD132 antigen; IL-2R subunit gamma; IL-2 receptor subunit gamma; common cytokine receptor gamma chain
• UniProt Protein Name: Cytokine receptor common subunit gamma
• UniProt Gene Name: IL2RG
• UniProt Synonym Gene Names: IL-2 receptor subunit gamma; IL-2R subunit gamma; IL-2RG
• UniProt Entry Name: IL2RG_HUMAN

NCBI Description

The protein encoded by this gene is an important signaling component of many interleukin receptors, including those of interleukin -2, -4, -7 and -21, and is thus referred to as the common gamma chain. Mutations in this gene cause X-linked severe combined immunodeficiency (XSCID), as well as X-linked combined immunodeficiency (XCID), a less severe immunodeficiency disorder. [provided by RefSeq, Mar 2010]

Uniprot Description

IL2RG: Common subunit for the receptors for a variety of interleukins. Defects in IL2RG are the cause of severe combined immunodeficiency X-linked T-cell-negative/B-cell-positive/NK-cell- negative (XSCID); also known as agammaglobulinemia Swiss type. A form of severe combined immunodeficiency (SCID), a genetically and clinically heterogeneous group of rare congenital disorders characterized by impairment of both humoral and cell- mediated immunity, leukopenia, and low or absent antibody levels. Patients present in infancy recurrent, persistent infections by opportunistic organisms. The common characteristic of all types of SCID is absence of T-cell-mediated cellular immunity due to a defect in T-cell development. Defects in IL2RG are the cause of X-linked combined immunodeficiency (XCID). XCID is a less severe form of X-linked immunodeficiency with a less severe degree of deficiency in cellular and humoral immunity than that seen in XSCID. Belongs to the type I cytokine receptor family. Type 5 subfamily.

Protein type: Membrane protein, integral; Receptor, cytokine

Chromosomal Location of Human Ortholog: Xq13.1

Cellular Component: membrane; integral to plasma membrane; plasma membrane; external side of plasma membrane

Molecular Function: protein binding; interleukin-4 receptor activity; interleukin-2 receptor activity; interleukin-7 binding; interleukin-7 receptor activity; interleukin-2 binding

Biological Process: viral reproduction; immune response; signal transduction

Disease: Combined Immunodeficiency, X-linked; Severe Combined Immunodeficiency, X-linked