Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human IL1R1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 55 kDa.)

IL1R1 recombinant protein

Recombinant Human IL1R1 Protein

Gene Names
IL1R1; P80; IL1R; IL1RA; CD121A; D2S1473; IL-1R-alpha
Purity
>95% by SDS-PAGE.
Synonyms
IL1R1; Recombinant Human IL1R1 Protein; CD121A; IL-1 RI; IL-1R-alpha; IL-1R1; IL1R; IL1RA; P80 CD121A; D2S1473; IL1R1 recombinant protein
Ordering
For Research Use Only!
Host
HEK293 Cells
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
DKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVT
Sequence Length
538
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human IL1R1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 55 kDa.)

SDS-Page (Recombinant Human IL1R1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 55 kDa.)
Related Product Information for IL1R1 recombinant protein
Description: Recombinant Human IL1R1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp21-Thr332) of human IL1R1 (Accession #NP_000868.1) fused with a 6xHis tag at the C-terminus.

Background: Interleukin 1 receptor, type I (IL-1R1) also known as CD121a (Cluster of Differentiation 121a), is an interleukin receptor. The protein encoded by this gene is a cytokine receptor that belongs to the interleukin-1 receptor family. This protein is a receptor for interleukin 1 alpha (IL1A), interleukin 1 beta (IL1B), and interleukin 1 receptor antagonist (IL1RA). The shape change and subsequent repair processes are IL-1beta activity-dependent, acting through the IL-1 type 1 receptor (IL-1R1), as co-application of the IL-1type 1 receptor antagonist protein (IL-1ra) blocks IL-1beta induced effects. This gene along with interleukin 1 receptor, type II (IL1R2), interleukin 1 receptor-like 2 (IL1RL2), and interleukin 1 receptor-like 1 (IL1RL1) form a cytokine receptor gene cluster in a region mapped to chromosome 2q12. It has been suggested that the Type II receptor, either as the membrane-bound or as the soluble form, serves as a decoy for IL-1 and inhibits IL-1 action by blocking the binding of IL-1 to the signaling Type I receptor complex. Recombinant IL-1 soluble receptor Type I is a potent antagonist of IL-1 action.
Product Categories/Family for IL1R1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
interleukin-1 receptor type 1 isoform 2
NCBI Official Synonym Full Names
interleukin 1 receptor type 1
NCBI Official Symbol
IL1R1
NCBI Official Synonym Symbols
P80; IL1R; IL1RA; CD121A; D2S1473; IL-1R-alpha
NCBI Protein Information
interleukin-1 receptor type 1
UniProt Protein Name
Interleukin-1 receptor type 1
Protein Family
UniProt Gene Name
IL1R1
UniProt Synonym Gene Names
IL1R; IL1RA; IL1RT1; IL-1R-1; IL-1RT-1; IL-1RT1; IL-1R-alpha; mIL-1R1; mIL-1RI; sIL-1R1; sIL-1RI
UniProt Entry Name
IL1R1_HUMAN

NCBI Description

This gene encodes a cytokine receptor that belongs to the interleukin-1 receptor family. The encoded protein is a receptor for interleukin-1 alpha, interleukin-1 beta, and interleukin-1 receptor antagonist. It is an important mediator involved in many cytokine-induced immune and inflammatory responses. This gene is located in a cluster of related cytokine receptor genes on chromosome 2q12. [provided by RefSeq, Dec 2013]

Uniprot Description

IL-1RA: Receptor for IL1A, IL1B and IL1RN. After binding to interleukin-1 associates with the corecptor IL1RAP to form the high affinity interleukin-1 receptor complex which mediates interleukin-1-dependent activation of NF-kappa-B, MAPK and other pathways. Signaling involves the recruitment of adapter molecules such as TOLLIP, MYD88, and IRAK1 or IRAK2 via the respective TIR domains of the receptor/coreceptor subunits. Binds ligands with comparable affinity and binding of antagonist IL1RN prevents association with IL1RAP to form a signaling complex. Belongs to the interleukin-1 receptor family.

Protein type: EC 2.7.11.25; Membrane protein, integral; Receptor, cytokine

Chromosomal Location of Human Ortholog: 2q12

Cellular Component: cell surface; membrane; integral to plasma membrane; plasma membrane; extracellular region

Molecular Function: interleukin-1, Type I, activating receptor activity; protein binding; signal transducer activity; transmembrane receptor activity; protease binding; platelet-derived growth factor receptor binding; interleukin-1 receptor activity

Biological Process: cell surface receptor linked signal transduction; regulation of inflammatory response; immune response

Research Articles on IL1R1

Similar Products

Product Notes

The IL1R1 il1r1 (Catalog #AAA9141871) is a Recombinant Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: DKCKEREEKI ILVSSANEID VRPCPLNPNE HKGTITWYKD DSKTPVSTEQ ASRIHQHKEK LWFVPAKVED SGHYYCVVRN SSYCLRIKIS AKFVENEPNL CYNAQAIFKQ KLPVAGDGGL VCPYMEFFKN ENNELPKLQW YKDCKPLLLD NIHFSGVKDR LIVMNVAEKH RGNYTCHASY TYLGKQYPIT RVIEFITLEE NKPTRPVIVS PANETMEVDL GSQIQLICNV TGQLSDIAYW KWNGSVIDED DPVLGEDYYS VENPANKRRS TLITVLNISE IESRFYKHPF TCFAKNTHGI DAAYIQLIYP VT. It is sometimes possible for the material contained within the vial of "IL1R1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.