Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Interleukin-17F Recombinant Protein | mIL 17F recombinant protein

Recombinant Mouse Interleukin-17F

Gene Names
Il17f; C87042; IL-17F
Purity
Greater than 97.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Synonyms
Interleukin-17F; Recombinant Mouse Interleukin-17F; IL17F Mouse; Interleukin-17F Mouse Recombinant; Cytokine ML-1; IL-17F; Interleukin-17F precursor; IL17F; ML1; ML-1; mIL 17F recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater than 97.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Form/Format
IL17F was lyophilized from a concentrated (1mg/ml) solution containing no additives.
Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence
RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA
Sequence Length
161
Solubility
It is recommended to reconstitute the lyophilized Mouse IL17F in sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
Preparation and Storage
Lyophilized Murine IL17F although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution IL17F should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Related Product Information for mIL 17F recombinant protein
Description: IL17F Mouse Recombinant produced in E Coli is a homodimeric, non-glycosylated polypeptide chain containing a total of 266 amino acids and having a molecular mass of 29.8 kDa. The Mouse IL-17F is purified by proprietary chromatographic techniques.

Introduction: IL-17F having an accession number of Q96PD4 is a cytokine that shares sequence similarity with IL17. IL-17F is expressed by activated T cells, and has been shown to stimulate the production of several other cytokines, including IL6, IL8, and CSF2/GM-CSF. IL-17F inhibits the angiogenesis of endothelial cells and induce endothelial cells to produce IL2, TGFB1/TGFB, and monocyte chemoattractant protein-1. IL-17F induces stromal cells to produce proinflammatory and hematopoietic cytokines. Intestinal IL17F gene expression is increased in active CD.IL-17A & IL-17F alleles influence the susceptibility to and pathophysiological features of ulcerative colitis independently. IL-17F and MIF gene polymorphisms are significantly associated with the development of functional dyspepsia. The initiation of IL-17F/IL-17R signaling pathway requires the receptor ubiquitination by TRAF6. IL-17F induces expression of IFN-gamma-inducible protein 10 (IP-10) by activating Raf1-mitogen-activated protein kinase 1/2-extracellular-regulated kinase 1/2-p90 ribosomal S6 kinase-cyclic AMP response element-binding protein signaling pathway.
Product Categories/Family for mIL 17F recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17,020 Da
NCBI Official Full Name
interleukin-17F
NCBI Official Synonym Full Names
interleukin 17F
NCBI Official Symbol
Il17f
NCBI Official Synonym Symbols
C87042; IL-17F
NCBI Protein Information
interleukin-17F
UniProt Protein Name
Interleukin-17F
Protein Family
UniProt Gene Name
Il17f
UniProt Synonym Gene Names
IL-17F
UniProt Entry Name
IL17F_MOUSE

Uniprot Description

IL17F: Stimulates the production of other cytokines such as IL- 6, IL-8 and granulocyte colony-stimulating factor, and can regulate cartilage matrix turnover. Stimulates PBMC and T-cell proliferation. Inhibits angiogenesis. Defects in IL17F are the cause of familial candidiasis type 6 (CANDF6). CANDF6 is a rare disorder with altered immune responses and impaired clearance of fungal infections, selective against Candida. It is characterized by persistent and/or recurrent infections of the skin, nails and mucous membranes caused by organisms of the genus Candida, mainly Candida albicans. Belongs to the IL-17 family.

Protein type: Cytokine; Secreted; Secreted, signal peptide

Cellular Component: extracellular space; extracellular region

Molecular Function: protein homodimerization activity; hematopoietin/interferon-class (D200-domain) cytokine receptor binding; cytokine binding; cytokine activity

Biological Process: proteoglycan metabolic process; negative regulation of angiogenesis; regulation of transforming growth factor beta receptor signaling pathway; regulation of interleukin-8 biosynthetic process; regulation of granulocyte macrophage colony-stimulating factor biosynthetic process; regulation of interleukin-2 biosynthetic process; cytokine biosynthetic process; lymphotoxin A biosynthetic process; cartilage development; regulation of interleukin-6 biosynthetic process; positive regulation of transcription from RNA polymerase II promoter; inflammatory response

Research Articles on mIL 17F

Similar Products

Product Notes

The mIL 17F il17f (Catalog #AAA143666) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: RKNPKAGVPA LQKAGNCPPL EDNTVRVDIR IFNQNQGISV PREFQNRSSS PWDYNITRDP HRFPSEIAEA QCRHSGCINA QGQEDSTMNS VAIQQEILVL RREPQGCSNS FRLEKMLLKV GCTCVKPIVH QAA. It is sometimes possible for the material contained within the vial of "Interleukin-17F, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.