Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

(Rhesus macaque) Pro-interleukin-16 (IL16) Recombinant Protein | IL16 recombinant protein

Recombinant Macaca mulatta (Rhesus macaque) Pro-interleukin-16 (IL16)

Gene Names
IL16; IL-16
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
(Rhesus macaque) Pro-interleukin-16 (IL16); Recombinant Macaca mulatta (Rhesus macaque) Pro-interleukin-16 (IL16); Recombinant (Rhesus macaque) Pro-interleukin-16 (IL16); Pro-interleukin-16 Cleaved into the following chain: 1. Interleukin-16; 2. IL-16; Lymphocyte chemoattractant factor; LCF; IL16 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
510-630
Sequence
SAASASAASDVSVESSAEATVYTVTLEKMSAGLGFSLEGGKGSLHGDKPLTINRIFKGAASEQSETIQPGDEILQLAGTAMQGLTRFEAWNIIKALPDGPVTIVIRRKSLQPKETTAAADS
Sequence Length
630
Species
Macaca mulatta (Rhesus macaque)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
66,563 Da
NCBI Official Full Name
pro-interleukin-16
NCBI Official Symbol
IL16
NCBI Official Synonym Symbols
IL-16
NCBI Protein Information
pro-interleukin-16; IL-16; interleukin 16 (lymphocyte chemoattractant factor)
UniProt Protein Name
Pro-interleukin-16
Protein Family
UniProt Gene Name
IL16
UniProt Synonym Gene Names
IL-16; LCF
UniProt Entry Name
IL16_MACMU

Uniprot Description

Function: Interleukin-16 stimulates a migratory response in CD4+ lymphocytes, monocytes, and eosinophils. Primes CD4+ T-cells for IL-2 and IL-15 responsiveness. Also induces T-lymphocyte expression of interleukin 2 receptor. Ligand for CD4

By similarity.Pro-interleukin-16 is involved in cell cycle progression in T-cells. Appears to be involved in transcriptional regulation of SKP2 and is probably part of a transcriptional repression complex on the core promoter of the SKP2 gene. May act as a scaffold for GABPB1 (the DNA-binding subunit the GABP transcription factor complex) and HDAC3 thus maintaining transcriptional repression and blocking cell cycle progression in resting T-cells

By similarity.

Subunit structure: Homotetramer

Probable. Pro-interleukin-16 interacts (via PDZ 2 domain) with PPP1R12A, PPP1R12B and PPP1R12C. Pro-interleukin-16 interacts with GRIN2A. Pro-interleukin-16 interacts with GABPB1. Pro-interleukin-16 interacts (via PDZ 3 domain) with HDAC3

By similarity.

Subcellular location: Interleukin-16: Secreted

By similarity. Pro-interleukin-16: Cytoplasm. Nucleus

By similarity.

Sequence similarities: Contains 2 PDZ (DHR) domains.

Similar Products

Product Notes

The IL16 il16 (Catalog #AAA1003331) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 510-630. The amino acid sequence is listed below: SAASASAASD VSVESSAEAT VYTVTLEKMS AGLGFSLEGG KGSLHGDKPL TINRIFKGAA SEQSETIQPG DEILQLAGTA MQGLTRFEAW NIIKALPDGP VTIVIRRKSL QPKETTAAAD S. It is sometimes possible for the material contained within the vial of "(Rhesus macaque) Pro-interleukin-16 (IL16), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.