Interleukin-12 subunit alpha (IL12A) Recombinant Protein | IL12A recombinant protein

Recombinant Sheep Interleukin-12 subunit alpha (IL12A)

Cat. Num. AAA1445870

• Gene Names: IL12A; IL12
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Interleukin-12 subunit alpha (IL12A); Recombinant Sheep Interleukin-12 subunit alpha (IL12A); IL12A recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 26-221, Full length protein
• Sequence: RSLPTTTAGPGTSCLDYSQNLLRAVSNTLQKARQTLEFYSCTSEEIDHEDITKDKTSTVEACLPLELATNESCLASRETSLITNGHCLSSGKTSFMTTLCLRSIYKDLKMYHMEFQAMNAKLLMDPKRQVFLDQNMLAAIAELMQALNFDSETVPQKPSLEELDFYKTKVKLCILLHAFRIRAVTIDRMMSYLSSS
• Sequence Length: 196

• Species: Sheep
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for IL12A recombinant protein

This gene encodes a subunit of a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. The cytokine is a disulfide-linked heterodimer composed of the 35-kD subunit encoded by this gene, and a 40-kD subunit that is a member of the cytokine receptor family. This cytokine is required for the T-cell-independent induction of interferon (IFN)-gamma, and is important for the differentiation of both Th1 and Th2 cells. The responses of lymphocytes to this cytokine are mediated by the activator of transcription protein STAT4. Nitric oxide synthase 2A (NOS2A
NOS2) is found to be required for the signaling process of this cytokine in innate immunity.

NCBI and Uniprot Product Information

• NCBI GI #: 57619206
• NCBI GeneID: 443064
• NCBI Accession #: NP_001009736.1
• NCBI GenBank Nucleotide #: NM_001009736.1
• UniProt Accession #: Q9TU27; Q9MYU0
• Molecular Weight: 24,859 Da
• NCBI Official Full Name: interleukin-12 subunit alpha
• NCBI Official Symbol: IL12A
• NCBI Official Synonym Symbols: IL12
• NCBI Protein Information: interleukin-12 subunit alpha
• UniProt Protein Name: Interleukin-12 subunit alpha
• Protein Family: Interleukin
• UniProt Gene Name: IL12A
• UniProt Synonym Gene Names: IL12P35; IL-12A; CLMF p35

Uniprot Description

Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated Killer cells, and stimulate the production of IFN-gamma by resting PBMC.