Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Interleukin-11 receptor subunit alpha-2 Recombinant Protein | Il11ra2 recombinant protein

Interleukin-11 receptor subunit alpha-2

Gene Names
Gm13305; OTTMUSG00000011351
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Interleukin-11 receptor subunit alpha-2; Il11ra2 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
24-432aa; full length protein
Sequence
SPCPQAWGPPGVQYGQPGRPVMLCCPGVSAGTPVSWFRDGDSRLLQGPDSGLGHRLVLAQVDSPDEGTYVCQTLDGVSGGMVTLKLGFPPARPEVSCQAVDYENFSCTWSPGQVSGLPTRYLTSYRKKTLPGAESQRESPSTGPWPCPQDPLEASRCVVHGAEFWSEYRINVTEVNPLGASTCLLDVRLQSILRPDPPQGLRVESVPGYPRRLHASWTYPASWRRQPHFLLKFRLQYRPAQHPAWSTVEPIGLEEVITDTVAGLPHAVRVSARDFLDAGTWSAWSPEAWGTPSTGLLQDEIPDWSQGHGQQLEAVVAQEDSLAPARPSLQPDPRPLDHRDPLEQVAVLASLGIFSCLGLAVGALALGLWLRLRRSGKEGPQKPGLLAPMIPVEKLPGIPNLQRTPENFS
Sequence Length
Full Length Protein
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Il11ra2 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for Il11ra2 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46,731 Da
NCBI Official Full Name
interleukin 11 receptor, alpha chain 2-like
NCBI Official Synonym Full Names
predicted gene 13305
NCBI Official Symbol
Gm13305
NCBI Official Synonym Symbols
OTTMUSG00000011351
NCBI Protein Information
interleukin 11 receptor, alpha chain 2-like
UniProt Protein Name
Interleukin-11 receptor subunit alpha-2
Protein Family
UniProt Gene Name
Il11ra2
UniProt Synonym Gene Names
IL-11 receptor subunit alpha-2; IL-11R subunit alpha-2; IL-11R-alpha-2; IL-11RA2; IL-11 receptor subunit beta; IL-11R subunit beta; IL-11R-beta; IL-11RB
UniProt Entry Name
I11RB_MOUSE

Uniprot Description

Receptor for interleukin-11. The receptor systems for IL6, LIF, OSM, CNTF, IL11 and CT1 can utilize IL6ST for initiating signal transmission. The IL11/IL11RA/IL6ST complex may be involved in the control of proliferation and/or differentiation of skeletogenic progenitor or other mesenchymal cells.

Similar Products

Product Notes

The Il11ra2 il11ra2 (Catalog #AAA7043595) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-432aa; full length protein. The amino acid sequence is listed below: SPCPQAWGPP GVQYGQPGRP VMLCCPGVSA GTPVSWFRDG DSRLLQGPDS GLGHRLVLAQ VDSPDEGTYV CQTLDGVSGG MVTLKLGFPP ARPEVSCQAV DYENFSCTWS PGQVSGLPTR YLTSYRKKTL PGAESQRESP STGPWPCPQD PLEASRCVVH GAEFWSEYRI NVTEVNPLGA STCLLDVRLQ SILRPDPPQG LRVESVPGYP RRLHASWTYP ASWRRQPHFL LKFRLQYRPA QHPAWSTVEP IGLEEVITDT VAGLPHAVRV SARDFLDAGT WSAWSPEAWG TPSTGLLQDE IPDWSQGHGQ QLEAVVAQED SLAPARPSLQ PDPRPLDHRD PLEQVAVLAS LGIFSCLGLA VGALALGLWL RLRRSGKEGP QKPGLLAPMI PVEKLPGIPN LQRTPENFS. It is sometimes possible for the material contained within the vial of "Interleukin-11 receptor subunit alpha-2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.