Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Zinc finger protein Aiolos (IKZF3) Recombinant Protein | IKZF3 recombinant protein

Recombinant Bovine Zinc finger protein Aiolos (IKZF3) , partial

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Zinc finger protein Aiolos (IKZF3); Recombinant Bovine Zinc finger protein Aiolos (IKZF3); partial; IKZF3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
14-507. Partial
Sequence
QEQSVPTEGSELLNDYDLTKAHETENVDGTEGPANEDEDIGDDSMKVKDEYSERDENVLKPEPMGNAEEPEIPYSYSREYNEYENIKLERHVVSYDSSRPTSGKMNCDVCGLSCISFNVLMVHKRSHTGERPFQCNQCGASFTQKGNLLRHIKLHTGEKPFKCHLCNYACQRRDALTGHLRTHSVEKPYKCEFCGRSYKQRSSLEEHKERCRTFLQSTDLGETASVEARHIKAEMGSERALVLDRLASNVAKRKSSMPQKFIGEKRHCFDVSYNPSYMYEKESEMIQTRMMDQAINNAISYLGAEALRPLVQTPPAPTSEMVPVISSMYPIALTRAEMPNGAPQELEKKNIHLPEKSLPSERGLSPTNSGHDSTDTDSNHEERQNHIYQQNPMVPPRARNGMPLLKEGPRSYDLLKPPPICPRDSIKVINKEGEVTDVYRCDHCRVLFLDYVMFTIHMGCHGFRDPFECNMCGYRSHDRYEFSSHIARGEHRAM
Species
Bovine
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for IKZF3 recombinant protein
This gene encodes a member of the Ikaros family of zinc-finger proteins. Three members of this protein family (Ikaros, Aiolos and Helios) are hematopoietic-specific transcription factors involved in the regulation of lymphocyte development. This gene product is a transcription factor that is important in the regulation of B lymphocyte proliferation and differentiation. Both Ikaros and Aiolos can participate in chromatin remodeling. Regulation of gene expression in B lymphocytes by Aiolos is complex as it appears to require the sequential formation of Ikaros homodimers, Ikaros
Aiolos heterodimers, and Aiolos homodimers. At least six alternative transcripts encoding different isoforms have been described.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58,154 Da
NCBI Official Full Name
zinc finger protein Aiolos
NCBI Official Synonym Full Names
IKAROS family zinc finger 3
NCBI Official Symbol
IKZF3
NCBI Protein Information
zinc finger protein Aiolos
UniProt Protein Name
Zinc finger protein Aiolos
Protein Family
UniProt Gene Name
IKZF3
UniProt Synonym Gene Names
ZNFN1A3

Uniprot Description

Transcription factor that plays an important role in the regulation of lymphocyte differentiation. Plays an essential role in regulation of B-cell differentiation, proliferation and maturation to an effector state. Involved in regulating BCL2 expression and controlling apoptosis in T-cells in an IL2-dependent manner ().

Similar Products

Product Notes

The IKZF3 ikzf3 (Catalog #AAA1119217) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 14-507. Partial. The amino acid sequence is listed below: QEQSVPTEGS ELLNDYDLTK AHETENVDGT EGPANEDEDI GDDSMKVKDE YSERDENVLK PEPMGNAEEP EIPYSYSREY NEYENIKLER HVVSYDSSRP TSGKMNCDVC GLSCISFNVL MVHKRSHTGE RPFQCNQCGA SFTQKGNLLR HIKLHTGEKP FKCHLCNYAC QRRDALTGHL RTHSVEKPYK CEFCGRSYKQ RSSLEEHKER CRTFLQSTDL GETASVEARH IKAEMGSERA LVLDRLASNV AKRKSSMPQK FIGEKRHCFD VSYNPSYMYE KESEMIQTRM MDQAINNAIS YLGAEALRPL VQTPPAPTSE MVPVISSMYP IALTRAEMPN GAPQELEKKN IHLPEKSLPS ERGLSPTNSG HDSTDTDSNH EERQNHIYQQ NPMVPPRARN GMPLLKEGPR SYDLLKPPPI CPRDSIKVIN KEGEVTDVYR CDHCRVLFLD YVMFTIHMGC HGFRDPFECN MCGYRSHDRY EFSSHIARGE HRAM . It is sometimes possible for the material contained within the vial of "Zinc finger protein Aiolos (IKZF3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.