Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Major outer membrane protein 1 (ihomp1) Recombinant Protein | Igni_1266 recombinant protein

Recombinant Ignicoccus hospitalis Major outer membrane protein 1 (ihomp1)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Major outer membrane protein 1 (ihomp1); Recombinant Ignicoccus hospitalis Major outer membrane protein 1 (ihomp1); Recombinant Major outer membrane protein 1 (ihomp1); Major outer membrane protein 1; Ihomp1; Outer membrane protein Imp1227; Igni_1266 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
19-85
Sequence
GIGYTAVIALAALVLVMGALGLVLKVAAAAGALPSEVAKVANALPGLKASVDANPAAGSLSSVSVST
Sequence Length
85
Species
Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
8,388 Da
NCBI Official Full Name
hypothetical protein Igni_1266
NCBI Official Symbol
Igni_1266
NCBI Protein Information
hypothetical protein
UniProt Protein Name
Major outer membrane protein 1
UniProt Gene Name
ihomp1
UniProt Synonym Gene Names
imp1227; Ihomp1
UniProt Entry Name
OMP1_IGNH4

Uniprot Description

Function: The most abundant protein of the outer membrane, it forms a pore through it.

Subunit structure: Forms extremely stable complexes with apparent masses of 150, 50, 45 and 38 kDa. Found in a ring-shaped complex of 7 nm diameter with a 2 nm channel through the middle. Complete denaturation requires temperatures over 110 degrees Celsius. Ref.3

Subcellular location: Cell outer membrane; Single-pass membrane protein

Probable Ref.2 Ref.3.

Miscellaneous: Ignicoccus hospitalis is unique in having an energized outer membrane while ATP synthesis occurs within the periplasmic space.

Similar Products

Product Notes

The Igni_1266 ihomp1 (Catalog #AAA1046801) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 19-85. The amino acid sequence is listed below: GIGYTAVIAL AALVLVMGAL GLVLKVAAAA GALPSEVAKV ANALPGLKAS VDANPAAGSL SSVSVST. It is sometimes possible for the material contained within the vial of "Major outer membrane protein 1 (ihomp1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.