Interleukin-28 receptor subunit alpha (IFNLR1) Recombinant Protein | IFNLR1 recombinant protein

Recombinant Human Interleukin-28 receptor subunit alpha (IFNLR1), partial

Cat. Num. AAA9018606

• Gene Names: IFNLR1; IFNLR; LICR2; IL28RA; CRF2/12; IL-28R1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Interleukin-28 receptor subunit alpha (IFNLR1); Recombinant Human Interleukin-28 receptor subunit alpha (IFNLR1); partial; Interferon lambda receptor 1(IFN-lambda receptor 1)(IFN-lambda-R1)(Cytokine receptor class-II member 12)(Cytokine receptor family 2 member 12)(CRF2-12)(Interleukin-28 receptor subunit alpha)(IL-28 receptor subunit alpha)(IL-28R-alpha)(IL-28RA)(Likely interleukin or cytokine receptor 2)(LICR2); IFNLR1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 21-228aa, Partial
• Sequence: RPRLAPPQNVTLLSQNFSVYLTWLPGLGNPQDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLFEVEPAPPVLVLTQTEEILSANATYQLPPCMPPLDLKYEVAFWKEGAGNKTLFPVTPHGQPVQITLQPAASEHHCLSARTIYTFSVPKYSKFSKPTCFLLEVPEANWA

• Species: Homo sapiens (Human)
• Relevance: The IFNLR1/IL10RB dimer is a receptor for the cytokine ligands IFNL2 and IFNL3 and mediates their antiviral activity. The ligand/receptor complex stimulate the activation of the JAK/STAT signaling pathway leading to the expression of IFN-stimulated genes (ISG), which contribute to the antiviral state. Determines the cell type specificity of the lambda interferon action. Shows a more restricted pattern of expression in the epithelial tissues thereby limiting responses to lambda interferons primarily to epithelial cells of the respiratory, gastrointestinal, and reproductive tracts. Seems not to be essential for early virus-activated host defense in vaginal infection, but plays an important role in Toll-like receptor (TLR)-induced antiviral defense. Plays a significant role in the antiviral immune defense in the intestinal epithelium.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

Product Categories/Family for IFNLR1 recombinant protein

Immunology

References

"IFN-lambdas mediate antiviral protection through a distinct class II cytokine receptor complex."Kotenko S.V., Gallagher G., Baurin V.V., Lewis-Antes A., Shen M., Shah N.K., Langer J.A., Sheikh F., Dickensheets H., Donnelly R.P.Nat. Immunol. 4:69-77(2003)

NCBI and Uniprot Product Information

• NCBI GI #: 55976528
• NCBI GeneID: 163702
• UniProt Accession #: Q8IU57; Q5VTX5; Q5VTX7; Q5VTX8; Q6ZML8; Q8IV66; Q8IZI7; Q8IZI8
• Molecular Weight: 57,653 Da
• NCBI Official Full Name: Interferon lambda receptor 1
• NCBI Official Synonym Full Names: interferon, lambda receptor 1
• NCBI Official Symbol: IFNLR1
• NCBI Official Synonym Symbols: IFNLR; LICR2; IL28RA; CRF2/12; IL-28R1
• NCBI Protein Information: interferon lambda receptor 1; CRF2-12; IL-28RA; IL-28R-alpha; IFN-lambda-R1; IFN-lambda receptor 1; interleukin 28 receptor A; IL-28 receptor subunit alpha; interferon lambda, receptor 1; interleukin 28 alpha receptor; class II cytokine receptor CRF2/12
• UniProt Protein Name: Interferon lambda receptor 1
• Protein Family: Interferon lambda receptor
• UniProt Gene Name: IFNLR1
• UniProt Synonym Gene Names: IL28RA; LICR2; IFN-lambda receptor 1; IFN-lambda-R1; CRF2-12; IL-28 receptor subunit alpha; IL-28R-alpha; IL-28RA; LICR2
• UniProt Entry Name: INLR1_HUMAN

NCBI Description

The protein encoded by this gene belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 10 receptor, beta (IL10RB). The receptor complex has been shown to interact with three closely related cytokines, including interleukin 28A (IL28A), interleukin 28B (IL28B), and interleukin 29 (IL29). The expression of all three cytokines can be induced by viral infection. The cells overexpressing this protein have been found to have enhanced responses to IL28A and IL29, but decreased response to IL28B. Three alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]

Uniprot Description

IL28RA: The IL28RA/IL10RB dimer is a receptor for IL28A, IL28B and IL29. The ligand/receptor complex seems to signal through the Jak-STAT pathway. Belongs to the type II cytokine receptor family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 1p36.11

Cellular Component: integral to membrane; interleukin-28 receptor complex

Molecular Function: hematopoietin/interferon-class (D200-domain) cytokine receptor activity; protein binding

Biological Process: negative regulation of cell proliferation; mucosal immune response; cytokine and chemokine mediated signaling pathway; regulation of defense response to virus by host; defense response to virus