SDS-Page
(Recombinant Human IFNalpha2a/IFN-alpha 2a Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)
IFNalpha2a/IFN-alpha 2a Recombinant Protein | IFN-Alpha-2 recombinant protein
Recombinant Human IFNalpha2a/IFN-alpha 2a Protein
Gene Names
IFNA2; IFNA; IFNA2B; leIF A; IFN-alphaA; IFN-alpha-2
Purity
>95% by SDS-PAGE.
Synonyms
IFNalpha2a/IFN-alpha 2a; Recombinant Human IFNalpha2a/IFN-alpha 2a Protein; Interferon Alpha-2; IFN-Alpha-2; Interferon Alpha-A; LeIF A; IFNA2; IFN-Alpha-2 recombinant protein
Host
E Coli
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Sequence
CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Sequence Length
188
Species
Human
Endotoxin
< 1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
No tag
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
SDS-Page
(Recombinant Human IFNalpha2a/IFN-alpha 2a Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)
SDS-Page
(Recombinant Human IFNalpha2a/IFN-alpha 2a Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)
Related Product Information for IFN-Alpha-2 recombinant protein
Description: Recombinant Human IFNalpha2a/IFN-alpha 2a Protein is produced by E. coli expression system. The target protein is expressed with sequence (Cys24-Glu188) of human IFNalpha2a/IFN-alpha 2a (Accession #P01563) fused with an initial Met at the N-terminus.
Background: At least 23 different variants of IFN- alpha are known. The individual proteins have molecular masses between 19-26 kDa and consist of proteins with lengths of 156-166 and 172 amino acids. All IFN- alpha subtypes possess acommon conserved sequence region between amino acid positions 115-151 while the amino-terminal endsare variable. Many IFN- alpha subtypes only differ in their sequences by one or two positions. Naturally occurringvariants also include proteins truncated by 10 amino acids at the carboxy-terminal end.
Background: At least 23 different variants of IFN- alpha are known. The individual proteins have molecular masses between 19-26 kDa and consist of proteins with lengths of 156-166 and 172 amino acids. All IFN- alpha subtypes possess acommon conserved sequence region between amino acid positions 115-151 while the amino-terminal endsare variable. Many IFN- alpha subtypes only differ in their sequences by one or two positions. Naturally occurringvariants also include proteins truncated by 10 amino acids at the carboxy-terminal end.
Product Categories/Family for IFN-Alpha-2 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
interferon alpha-2
NCBI Official Synonym Full Names
interferon alpha 2
NCBI Official Symbol
IFNA2
NCBI Official Synonym Symbols
IFNA; IFNA2B; leIF A; IFN-alphaA; IFN-alpha-2
NCBI Protein Information
interferon alpha-2
UniProt Protein Name
Interferon alpha-2
UniProt Gene Name
IFNA2
UniProt Synonym Gene Names
IFNA2A; IFNA2B; IFNA2C; IFN-alpha-2; LeIF A
UniProt Entry Name
IFNA2_HUMAN
NCBI Description
This gene is a member of the alpha interferon gene cluster on chromosome 9. The encoded protein is a cytokine produced in response to viral infection. Use of the recombinant form of this protein has been shown to be effective in reducing the symptoms and duration of the common cold. [provided by RefSeq, Jun 2011]
Research Articles on IFN-Alpha-2
Similar Products
Product Notes
The IFN-Alpha-2 ifna2 (Catalog #AAA9139912) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: CDLPQTHSLG SRRTLMLLAQ MRKISLFSCL KDRHDFGFPQ EEFGNQFQKA ETIPVLHEMI QQIFNLFSTK DSSAAWDETL LDKFYTELYQ QLNDLEACVI QGVGVTETPL MKEDSILAVR KYFQRITLYL KEKKYSPCAW EVVRAEIMRS FSLSTNLQES LRSKE. It is sometimes possible for the material contained within the vial of "IFNalpha2a/IFN-alpha 2a, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
