Interferon alpha-14 Recombinant Protein | IFNA14 recombinant protein

Recombinant Human Interferon alpha-14

Cat. Num. AAA961403

• Gene Names: IFNA14; LEIF2H; IFN-alphaH
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Interferon alpha-14; Recombinant Human Interferon alpha-14; Interferon alpha-H; LeIF HInterferon lambda-2-H; IFNA14 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 24-189aa; Full Length of Mature Protein
• Sequence: CNLSQTHSLNNRRTLMLMAQMRRISPFSCLKDRHDFEFPQEEFDGNQFQKAQAISVLHEMMQQTFNLFSTKNSSAAWDETLLEKFYIELFQQMNDLEACVIQEVGVEETPLMNEDSILAVKKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD

• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-Page

Related Product Information for IFNA14 recombinant protein

Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.

Product Categories/Family for IFNA14 recombinant protein

Immunology

References

The structure of eight distinct cloned human leukocyte interferon cDNAs.Goeddel D.V., Leung D.W., Dull T.J., Gross M., Lawn R.M., McCandliss R., Seeburg P.H., Ullrich A., Yelverton E., Gray P.W.Nature 290:20-26(1981) DNA sequence of two closely linked human leukocyte interferon genes.Lawn R.M., Adelman J., Dull T.J., Gross M., Goeddel D.V., Ullrich A.Science 212:1159-1162(1981) Structural relationship of human interferon alpha genes and pseudogenes.Henco K., Brosius J., Fujisawa A., Fujisawa J., Haynes J.R., Hochstadt J., Kovacic T., Pasek M., Schamboeck A., Schmid J., Todokoro K., Waelchli M., Nagata S., Weissmann C.J. Mol. Biol. 185:227-260(1985) DNA sequence and analysis of human chromosome 9.Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.Nature 429:369-374(2004)

NCBI and Uniprot Product Information

• NCBI GI #: 170763491
• NCBI GeneID: 3448
• NCBI Accession #: NP_002163.2
• NCBI GenBank Nucleotide #: NM_002172.2
• UniProt Accession #: P01570; Q5VZ56; Q7M4S1
• Molecular Weight: 21.7 kDa
• NCBI Official Full Name: interferon alpha-14
• NCBI Official Synonym Full Names: interferon, alpha 14
• NCBI Official Symbol: IFNA14
• NCBI Official Synonym Symbols: LEIF2H; IFN-alphaH
• NCBI Protein Information: interferon alpha-14
• UniProt Protein Name: Interferon alpha-14
• Protein Family: Interferon
• UniProt Gene Name: IFNA14
• UniProt Synonym Gene Names: IFN-alpha-14; LeIF H
• UniProt Entry Name: IFN14_HUMAN

Uniprot Description

IFNA14: Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. Belongs to the alpha/beta interferon family.

Protein type: Membrane protein, integral; Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 9p22

Cellular Component: extracellular region; extracellular space

Molecular Function: cytokine activity; hematopoietin/interferon-class (D200-domain) cytokine receptor binding; interferon-alpha/beta receptor binding

Biological Process: adaptive immune response; B cell differentiation; B cell proliferation; blood coagulation; cytokine and chemokine mediated signaling pathway; defense response to virus; humoral immune response; innate immune response; natural killer cell activation during immune response; positive regulation of peptidyl-serine phosphorylation of STAT protein; response to exogenous dsRNA; T cell activation during immune response