Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

3-ketoacyl-CoA reductase (IFA38) Recombinant Protein | IFA38 recombinant protein

Recombinant Saccharomyces cerevisiae 3-ketoacyl-CoA reductase (IFA38)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
3-ketoacyl-CoA reductase (IFA38); Recombinant Saccharomyces cerevisiae 3-ketoacyl-CoA reductase (IFA38); Recombinant 3-ketoacyl-CoA reductase (IFA38); 3-ketoacyl-CoA reductase; 3-ketoreductase; KAR EC= 1.1.1.-; Microsomal beta-keto-reductase; IFA38 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-347
Sequence
MTFMQQLQEAGERFRCINGLLWVVFGLGVLKCTTLSLRFLALIFDLFLLPAVNFDKYGAKTGKYCAITGASDGIGKEFARQMAKRGFNLVLISRTQSKLEALQKELEDQHHVVVKILAIDIAEDKESNYESIKELCAQLPITVLVNNVGQSHSIPVPFLETEEKELRNIITINNTATLLITQIIAPKIVETVKAENKKSGTRGLILTMGSFGGLIPTPLLATYSGSKSFLQGWSNSLAGELSKDAIDVELIISYLVTSSMSKIRRSSLMIPNPQQFVKSTLRSVGRRCGSQERYATMTPYWAHAVYQFVITETFGVYSKIVNSINYSFHKSIRIRALKKAARQVKKE
Sequence Length
347
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,708 Da
NCBI Official Full Name
Ifa38p
NCBI Official Symbol
IFA38
NCBI Protein Information
Ifa38p
UniProt Protein Name
Very-long-chain 3-oxoacyl-CoA reductase
UniProt Gene Name
IFA38
UniProt Synonym Gene Names
3-ketoreductase; KAR
UniProt Entry Name
MKAR_YEAST

Uniprot Description

Function: Component of the microsomal membrane bound fatty acid elongation system, which produces the 26-carbon very long-chain fatty acids (VLCFA) from palmitate. Catalyzes the reduction of the 3-ketoacyl-CoA intermediate that is formed in each cycle of fatty acid elongation. VLCFAs serve as precursors for ceramide and sphingolipids. Ref.4 Ref.5 Ref.6

Catalytic activity: A very-long-chain (3R)-3-hydroxyacyl-CoA + NADP+ = a very-long-chain 3-oxoacyl-CoA + NADPH. Ref.5

Subunit structure: Interacts with the fatty acid elongation system components ELO3 and TSC13. Ref.5

Subcellular location: Endoplasmic reticulum membrane; Single-pass membrane protein

Potential Ref.5 Ref.7.

Miscellaneous: Present with 41900 molecules/cell in log phase SD medium. HAMAP-Rule MF_03107

Sequence similarities: Belongs to the short-chain dehydrogenases/reductases (SDR) family.

Similar Products

Product Notes

The IFA38 ifa38 (Catalog #AAA1201971) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-347. The amino acid sequence is listed below: MTFMQQLQEA GERFRCINGL LWVVFGLGVL KCTTLSLRFL ALIFDLFLLP AVNFDKYGAK TGKYCAITGA SDGIGKEFAR QMAKRGFNLV LISRTQSKLE ALQKELEDQH HVVVKILAID IAEDKESNYE SIKELCAQLP ITVLVNNVGQ SHSIPVPFLE TEEKELRNII TINNTATLLI TQIIAPKIVE TVKAENKKSG TRGLILTMGS FGGLIPTPLL ATYSGSKSFL QGWSNSLAGE LSKDAIDVEL IISYLVTSSM SKIRRSSLMI PNPQQFVKST LRSVGRRCGS QERYATMTPY WAHAVYQFVI TETFGVYSKI VNSINYSFHK SIRIRALKKA ARQVKKE. It is sometimes possible for the material contained within the vial of "3-ketoacyl-CoA reductase (IFA38), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.