Radiation-inducible immediate-early gene IEX-1 Recombinant Protein | Ier3 recombinant protein
Radiation-inducible immediate-early gene IEX-1
Gene Names
Ier3; cI-3; IEX-1; gly96; AI663993
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Radiation-inducible immediate-early gene IEX-1; Ier3 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-153aa; full length protein
Sequence
MCHSRNHLHTMTGLRAPSPAPSTGPELRRGSGPEIFTFDPLPERAVVSTARLNTSRGHRKRSRRVLYPRVVRRQLPTEEPNIAKRVLFLLFAIIFCQILMAEEGVSQPLAPEDATSAVTPEPISAPITAPPVLEPLNLTSESSDYALDLKAFL
Sequence Length
Full Length Protein
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Ier3 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for Ier3 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
16,875 Da
NCBI Official Full Name
Radiation-inducible immediate-early gene IEX-1
NCBI Official Synonym Full Names
immediate early response 3
NCBI Official Symbol
Ier3
NCBI Official Synonym Symbols
cI-3; IEX-1; gly96; AI663993
NCBI Protein Information
radiation-inducible immediate-early gene IEX-1
UniProt Protein Name
Radiation-inducible immediate-early gene IEX-1
Protein Family
UniProt Gene Name
Ier3
UniProt Synonym Gene Names
Gly96; Iex1
UniProt Entry Name
IEX1_MOUSE
Uniprot Description
IEX-1: May play a role in the ERK signaling pathway by inhibiting the dephosphorylation of ERK by phosphatase PP2A- PPP2R5C holoenzyme. Acts also as an ERK downstream effector mediating survival. Belongs to the IER3 family.
Protein type: Apoptosis; Membrane protein, integral
Cellular Component: nucleus
Molecular Function: protein binding
Biological Process: DNA damage response, signal transduction resulting in induction of apoptosis; mitotic cell cycle G2/M transition DNA damage checkpoint; negative regulation of glycolysis; negative regulation of inflammatory response; negative regulation of systemic arterial blood pressure; positive regulation of protein catabolic process; regulation of DNA repair; regulation of nucleocytoplasmic transport; response to protozoan
Research Articles on Ier3
Similar Products
Product Notes
The Ier3 ier3 (Catalog #AAA7042880) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-153aa; full length protein. The amino acid sequence is listed below: MCHSRNHLHT MTGLRAPSPA PSTGPELRRG SGPEIFTFDP LPERAVVSTA RLNTSRGHRK RSRRVLYPRV VRRQLPTEEP NIAKRVLFLL FAIIFCQILM AEEGVSQPLA PEDATSAVTP EPISAPITAP PVLEPLNLTS ESSDYALDLK AFL. It is sometimes possible for the material contained within the vial of "Radiation-inducible immediate-early gene IEX-1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
