DNA-binding protein inhibitor ID-3-A (id3-a) Recombinant Protein | id3-a recombinant protein

Recombinant Xenopus laevis DNA-binding protein inhibitor ID-3-A (id3-a)

Cat. Num. AAA1304234

• Gene Names: id3.L; id3; XId3; XIdI; XIdx; XIdIa; XIdIb; id3-a; id3-b; heir-1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: DNA-binding protein inhibitor ID-3-A (id3-a); Recombinant Xenopus laevis DNA-binding protein inhibitor ID-3-A (id3-a); id3-a recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-118, Full length protein
• Sequence: MKAISPVRSMSSCYQAVCCLSEQSLSIARGSSHKGPGMDEPMGLLYDMNGCYSKLKELVPGIPQGSKLSQVEILQHVIDYIFDLQIVLGEDQQQSSILSLQKSDFSELATQGDTSVCH
• Sequence Length: 118

• Species: Xenopus laevis (African clawed frog)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 147899694
• NCBI GeneID: 379222
• NCBI Accession #: NP_001079535.1
• NCBI GenBank Nucleotide #: NM_001086066.1
• UniProt Accession #: Q91399; Q91417
• Molecular Weight: 12,857 Da
• NCBI Official Full Name: DNA-binding protein inhibitor ID-3-A
• NCBI Official Synonym Full Names: inhibitor of DNA binding 3, HLH protein L homeolog
• NCBI Official Symbol: id3.L
• NCBI Official Synonym Symbols: id3; XId3; XIdI; XIdx; XIdIa; XIdIb; id3-a; id3-b; heir-1
• NCBI Protein Information: DNA-binding protein inhibitor ID-3-A
• UniProt Protein Name: DNA-binding protein inhibitor ID-3-A
• Protein Family: DNA-binding protein inhibitor
• UniProt Gene Name: id3-a
• UniProt Synonym Gene Names: XIdx

Uniprot Description

Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Influences cell fate decisions in the embryo by sequestering and blocking the activity of the bHLH transcription factors that control these decisions. Inhibits the binding of myogenic bHLH-containing complexes to E-box DNA, thereby preventing activation of muscle-specific target genes. Also inhibits the activity of neurogenic factor neurod1/neuroD. Plays a role in cell cycle progression and survival of neural crest progenitors; binding to either hes4-B/hairy2b or stat3 blocks the formation of transcription factor complexes and the repressor function of hes4-B/hairy2B, to allow neural crest progenitors to differentiate. May play a role in the regulation of the circadian rhythm.