Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Intercellular adhesion molecule 1 Recombinant Protein | ICAM1 recombinant protein

Intercellular adhesion molecule 1

Gene Names
ICAM1; BB2; CD54; P3.58
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Intercellular adhesion molecule 1; ICAM1 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
28-532aa; full length protein
Sequence
QTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYEIVIITVVAAAVIMGTAGLSTYLYNRQRKIKKYRLQQAQKGTPMKPNTQATPP
Sequence Length
Full Length Protein
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for ICAM1 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for ICAM1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57,825 Da
NCBI Official Full Name
intercellular adhesion molecule 1
NCBI Official Synonym Full Names
intercellular adhesion molecule 1
NCBI Official Symbol
ICAM1
NCBI Official Synonym Symbols
BB2; CD54; P3.58
NCBI Protein Information
intercellular adhesion molecule 1
UniProt Protein Name
Intercellular adhesion molecule 1
UniProt Gene Name
ICAM1
UniProt Synonym Gene Names
ICAM-1
UniProt Entry Name
ICAM1_HUMAN

NCBI Description

This gene encodes a cell surface glycoprotein which is typically expressed on endothelial cells and cells of the immune system. It binds to integrins of type CD11a / CD18, or CD11b / CD18 and is also exploited by Rhinovirus as a receptor. [provided by RefSeq, Jul 2008]

Uniprot Description

ICAM1: a type I membrane protein of the immunoglobulin superfamily. Is a ligand for the leukocyte adhesion LFA-1 protein (Integrin alpha-L/beta-2) and a Rhinovirus receptor. Typically expressed on endothelial cells and cells of the immune system. ICAM1 binds to integrins of type CD11a / CD18, or CD11b / CD18. Its expression is activated by p53 in an NF-kappaB-independent manner. Induced by TNFalpha in a process that involves IKKbeta.

Protein type: Membrane protein, integral; Immunoglobulin superfamily; Cell adhesion

Chromosomal Location of Human Ortholog: 19p13.3-p13.2

Cellular Component: cell surface; extracellular space; focal adhesion; integral to plasma membrane; membrane; plasma membrane

Molecular Function: integrin binding; protein binding; receptor activity; transmembrane receptor activity

Biological Process: adhesion to host; cell adhesion; extracellular matrix organization and biogenesis; heterophilic cell adhesion; leukocyte adhesion; leukocyte migration; membrane to membrane docking; positive regulation of cellular extravasation; regulation of immune response; regulation of leukocyte mediated cytotoxicity; T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell; virion attachment, binding of host cell surface receptor

Disease: Malaria, Susceptibility To

Research Articles on ICAM1

Similar Products

Product Notes

The ICAM1 icam1 (Catalog #AAA7042872) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 28-532aa; full length protein. The amino acid sequence is listed below: QTSVSPSKVI LPRGGSVLVT CSTSCDQPKL LGIETPLPKK ELLLPGNNRK VYELSNVQED SQPMCYSNCP DGQSTAKTFL TVYWTPERVE LAPLPSWQPV GKNLTLRCQV EGGAPRANLT VVLLRGEKEL KREPAVGEPA EVTTTVLVRR DHHGANFSCR TELDLRPQGL ELFENTSAPY QLQTFVLPAT PPQLVSPRVL EVDTQGTVVC SLDGLFPVSE AQVHLALGDQ RLNPTVTYGN DSFSAKASVS VTAEDEGTQR LTCAVILGNQ SQETLQTVTI YSFPAPNVIL TKPEVSEGTE VTVKCEAHPR AKVTLNGVPA QPLGPRAQLL LKATPEDNGR SFSCSATLEV AGQLIHKNQT RELRVLYGPR LDERDCPGNW TWPENSQQTP MCQAWGNPLP ELKCLKDGTF PLPIGESVTV TRDLEGTYLC RARSTQGEVT RKVTVNVLSP RYEIVIITVV AAAVIMGTAG LSTYLYNRQR KIKKYRLQQA QKGTPMKPNT QATPP. It is sometimes possible for the material contained within the vial of "Intercellular adhesion molecule 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.