Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Auxin-responsive protein IAA17 (IAA17) Recombinant Protein | IAA17 recombinant protein

Recombinant Arabidopsis thaliana Auxin-responsive protein IAA17 (IAA17)

Gene Names
AXR3; AtIAA17; AUXIN RESISTANT 3; F19P19.31; F19P19_31; IAA17; indole-3-acetic acid inducible 17
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Auxin-responsive protein IAA17 (IAA17); Recombinant Arabidopsis thaliana Auxin-responsive protein IAA17 (IAA17); IAA17 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-229aa; Full Length
Sequence
MMGSVELNLRETELCLGLPGGDTVAPVTGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACPKDPAKPPAKAQVVGWPPVRSYRKNVMVSCQKSSGGPEAAAFVKVSMDGAPYLRKIDLRMYKSYDELSNALSNMFSSFTMGKHGGEEGMIDFMNERKLMDLVNSWDYVPSYEDKDGDWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSRA
Sequence Length
229
Species
Arabidopsis thaliana (Mouse-ear cress)
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32.3 kDa
NCBI Official Full Name
AUX/IAA transcriptional regulator family protein
NCBI Official Symbol
AXR3
NCBI Official Synonym Symbols
AtIAA17; AUXIN RESISTANT 3; F19P19.31; F19P19_31; IAA17; indole-3-acetic acid inducible 17
NCBI Protein Information
AUX/IAA transcriptional regulator family protein
UniProt Protein Name
Auxin-responsive protein IAA17
Protein Family
UniProt Gene Name
IAA17
UniProt Synonym Gene Names
AXR3

NCBI Description

Transcription regulator acting as repressor of auxin-inducible gene expression. Auxin-inducible AUX/IAA gene. Short-lived nuclear protein with four conserved domains. Domain III has homology to beta alpha alpha dimerization and DNA binding domains. Involved in auxin signaling. Auxin induces the degradation of the protein in a dosage-dependent manner in a process mediated by AtRac1. Auxin induced the relocalization of the protein within the nucleus from a diffused nucleoplasmic pattern to a discrete particulated pattern named nuclear protein bodies or NPB in a process also mediated by Rac1. Colocalizes with SCF, CSN and 26S proteasome components.

Uniprot Description

Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations. Repression is thought to result from the interaction with auxin response factors (ARFs), proteins that bind to the auxin-responsive promoter element (AuxRE). Formation of heterodimers with ARF proteins may alter their ability to modulate early auxin response genes expression.

Research Articles on IAA17

Similar Products

Product Notes

The IAA17 iaa17 (Catalog #AAA1157622) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-229aa; Full Length. The amino acid sequence is listed below: MMGSVELNLR ETELCLGLPG GDTVAPVTGN KRGFSETVDL KLNLNNEPAN KEGSTTHDVV TFDSKEKSAC PKDPAKPPAK AQVVGWPPVR SYRKNVMVSC QKSSGGPEAA AFVKVSMDGA PYLRKIDLRM YKSYDELSNA LSNMFSSFTM GKHGGEEGMI DFMNERKLMD LVNSWDYVPS YEDKDGDWML VGDVPWPMFV DTCKRLRLMK GSDAIGLAPR AMEKCKSRA. It is sometimes possible for the material contained within the vial of "Auxin-responsive protein IAA17 (IAA17), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.