Mouse anti-Human CTNNB1 Monoclonal Antibody | anti-CTNNB1 antibody

CTNNB1 (Catenin beta-1, Beta-catenin, CTNNB, OK/SW-cl.35, PRO2286) (AP)

• Gene Names: CTNNB1; EVR7; CTNNB; MRD19; NEDSDV; armadillo
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CTNNB1; Monoclonal Antibody; CTNNB1 (Catenin beta-1; Beta-catenin; CTNNB; OK/SW-cl.35; PRO2286) (AP); anti-CTNNB1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1C9
• Specificity: Recognizes human CTNNB1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 781

• Applicable Applications for anti-CTNNB1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa682-781 from human CTNNB1 (AAH58926) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(Western Blot analysis of CTNNB1 expression in transfected 293T cell line by CTNNB1 monoclonal antibody. Lane 1: CTNNB1 transfected lysate (85.5kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(Western Blot detection against Immunogen (36.74kD).)

Application Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between FLT1 and CTNNB1. Huh7 cells were stained with FLT1 rabbit purified polyclonal 1:1200 and CTNNB1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Application Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between GSK3B and CTNNB1. HeLa cells were stained with GSK3B rabbit purified polyclonal 1:1200 and CTNNB1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

WB (Western Blot)

(Western blot analysis of CTNNB1 over-expressed 293 cell line, cotransfected with CTNNB1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CTNNB1 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Application Data

(Detection limit for recombinant GST tagged CTNNB1 is 0.1ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to CTNNB1 on HeLa cell. [antibody concentration 10ug/ml].)

Product Categories/Family for anti-CTNNB1 antibody

Antibodies; Catenin

NCBI and Uniprot Product Information

• NCBI GI #: 37590638
• NCBI GeneID: 1499
• NCBI Accession #: AAH58926
• NCBI GenBank Nucleotide #: NM_001904
• UniProt Accession #: P35222
• NCBI Official Full Name: Catenin (cadherin-associated protein), beta 1, 88kDa
• NCBI Official Synonym Full Names: catenin beta 1
• NCBI Official Symbol: CTNNB1
• NCBI Official Synonym Symbols: EVR7; CTNNB; MRD19; NEDSDV; armadillo
• NCBI Protein Information: catenin beta-1
• UniProt Protein Name: Catenin beta-1
• Protein Family: Catenin
• UniProt Gene Name: CTNNB1
• UniProt Synonym Gene Names: CTNNB
• UniProt Entry Name: CTNB1_HUMAN