Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Probable GDP-mannose transporter 2 (HVG1) Recombinant Protein | HVG1 recombinant protein

Recombinant Saccharomyces cerevisiae Probable GDP-mannose transporter 2 (HVG1)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable GDP-mannose transporter 2 (HVG1); Recombinant Saccharomyces cerevisiae Probable GDP-mannose transporter 2 (HVG1); Recombinant Probable GDP-mannose transporter 2 (HVG1); Probable GDP-mannose transporter 2; GMT 2; HVG1 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-249
Sequence
MIYTSSKSLQYLAVPIYTIFKNLTIILIAYGEVLFFGGKVTSMELTSFIMMVLSSVVATWGDQQAIAIKASSLEDLDQELVESTIFVLNPGYLWMFTNCISSALFVLIMRKRIRLTNFKDYDTMFYNNVLALPLLLVFSFIMEDWSTKNLSVNLSADSLAAMVISGLMSVGISYCSGWCVRVTSSTTYSMVGALNKLPIALAGLVFFDAPKNFLSFFSIFLGFLSGLLYAVAKQKKIQQQKVLAATLEK
Sequence Length
249
Species
Saccharomyces cerevisiae (strain RM11-1a) (Baker's yeast)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

UniProt Accession #
Molecular Weight
27,688 Da
UniProt Protein Name
Probable GDP-mannose transporter 2
UniProt Gene Name
HVG1
UniProt Synonym Gene Names
YEM9; GMT 2
UniProt Entry Name
GMT2_YEAS1

Uniprot Description

Function: Involved in the import of GDP-mannose from the cytoplasm into the Golgi lumen

By similarity.

Subcellular location: Golgi apparatus membrane; Multi-pass membrane protein

By similarity. Cytoplasmic vesicle membrane; Multi-pass membrane protein

By similarity. Endoplasmic reticulum membrane; Multi-pass membrane protein

By similarity. Note: Recycles between the Golgi apparatus and the endoplasmic reticulum

By similarity.

Sequence similarities: Belongs to the TPT transporter family. SLC35D subfamily.

Caution: This is a truncated version of GDP-mannose transporter 2. This strain has a stop codon in position 73, which disrupts the gene coding for this protein and produces two ORFs. A contiguous sequence for GDP-mannose transporter 2 can be found in strain Lalvin EC1118 (AC C8Z742).

Similar Products

Product Notes

The Probable GDP-mannose transporter 2 (HVG1) hvg1 (Catalog #AAA1008718) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-249. The amino acid sequence is listed below: MIYTSSKSLQ YLAVPIYTIF KNLTIILIAY GEVLFFGGKV TSMELTSFIM MVLSSVVATW GDQQAIAIKA SSLEDLDQEL VESTIFVLNP GYLWMFTNCI SSALFVLIMR KRIRLTNFKD YDTMFYNNVL ALPLLLVFSF IMEDWSTKNL SVNLSADSLA AMVISGLMSV GISYCSGWCV RVTSSTTYSM VGALNKLPIA LAGLVFFDAP KNFLSFFSIF LGFLSGLLYA VAKQKKIQQQ KVLAATLEK. It is sometimes possible for the material contained within the vial of "Probable GDP-mannose transporter 2 (HVG1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.