E3 ubiquitin-protein ligase HUWE1 (Huwe1) Recombinant Protein | Huwe1 recombinant protein
Recombinant Rat E3 ubiquitin-protein ligase HUWE1 (Huwe1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
E3 ubiquitin-protein ligase HUWE1 (Huwe1); Recombinant Rat E3 ubiquitin-protein ligase HUWE1 (Huwe1); Huwe1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-322, Full length protein
Sequence
EEGQDAGGLLREWYMIISREMFNPMYALFRTSPGDRVTYTINPSSHCNPNHLSYFKFVGRIVAKAVYDNRLLECYFTRSFYKHILGKSVRYTDMESEDYHFYQGLVYLLENDVSTLGYDLTFSTEVQEFGVCEVRDLKPNGANILVTEENKKEYVHLVCQMRMTGAIRKQLAAFLEGFYEIIPKRLISIFTEQELELLISGLPTIDIDDLKSNTEYHKYQSNSIQIQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFAALEGMNGIQKFQIHRDDRSTDRLPSAHTCFNQLDLPAYESFEKLRHMLLLAIQECSEGFGLA
Sequence Length
322
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Huwe1 recombinant protein
This gene encodes a member of the HECT E3 ubiquitin ligase family. The HECT domain lies in the C-terminus and contains the active-site cysteine which forms an intermediate ubiquitin-thioester bond. E3 family members are divided into three subfamilies based on their protein-protein interaction domains; this gene encodes a member of the SI(ngle)-HECT E3 subfamily. In lung, breast, and colorectal carcinomas, this gene is highly expressed. Mutations in this gene has been found in 3 unrelated families with X-linked syndromic mental retardation, Turner type.
NCBI and Uniprot Product Information
NCBI GI #
UniProt Accession #
Molecular Weight
37,361 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase HUWE1
UniProt Protein Name
E3 ubiquitin-protein ligase HUWE1
Protein Family
UniProt Gene Name
Huwe1
UniProt Synonym Gene Names
Ureb1; URE-B1; URE-binding protein 1
Uniprot Description
E3 ubiquitin-protein ligase which mediates ubiquitination and subsequent proteasomal degradation of target proteins. Regulates apoptosis by catalyzing the polyubiquitination and degradation of MCL1. Mediates monoubiquitination of DNA polymerase beta (POLB) at 'Lys-41', 'Lys-61' and 'Lys-81', thereby playing a role in base-excision repair. Also ubiquitinates the p53/TP53 tumor suppressor and core histones including H1, H2A, H2B, H3 and H4 (). Binds to an upstream initiator-like sequence in the preprodynorphin gene. Regulates neural differentiation and proliferation by catalyzing the polyubiquitination and degradation of MYCN. May regulate abundance of CDC6 after DNA damage by polyubiquitinating and targeting CDC6 to degradation (). Mediates polyubiquitination of PA2G4 ().
Similar Products
Product Notes
The Huwe1 huwe1 (Catalog #AAA953032) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-322, Full length protein. The amino acid sequence is listed below: EEGQDAGGLL REWYMIISRE MFNPMYALFR TSPGDRVTYT INPSSHCNPN HLSYFKFVGR IVAKAVYDNR LLECYFTRSF YKHILGKSVR YTDMESEDYH FYQGLVYLLE NDVSTLGYDL TFSTEVQEFG VCEVRDLKPN GANILVTEEN KKEYVHLVCQ MRMTGAIRKQ LAAFLEGFYE IIPKRLISIF TEQELELLIS GLPTIDIDDL KSNTEYHKYQ SNSIQIQWFW RALRSFDQAD RAKFLQFVTG TSKVPLQGFA ALEGMNGIQK FQIHRDDRST DRLPSAHTCF NQLDLPAYES FEKLRHMLLL AIQECSEGFG LA. It is sometimes possible for the material contained within the vial of "E3 ubiquitin-protein ligase HUWE1 (Huwe1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
