Highly validated and characterized monoclonal/polyclonal
antibodies and recombinant
proteins
The majority of AAA Biotech’s antibodies are highly validated and can be use in multiple
applications such as ELISA, FC,
ICC, IF, IHC, IP, WB, etc. We have antibodies available for rare species, in multiple conjugated
forms or recombinant
antibodies.
As for our high quality proteins, the majority have 90% purity, detected by SDS-PAGE while some are
available in
different tags such as Flag, GST, His, MBP, etc. We also carry high quality native and biologically
active proteins.
AAA Biotech is constantly working to expand our capacity to provide recombinant proteins and
antibodies to most
target proteins.
SELECT `p`.*, `pd`.*, IFNULL(pdns.ncbi_summary, "N/A") as ncbi_summary_pdns, IFNULL(pdns.sp_comments, "N/A") as sp_comments_pdns, IFNULL(pdns.ncbi_research_articles, "N/A") as ncbi_research_articles_pdns, IFNULL(pe.products_description_extra, "N/A") as products_description_extra
FROM (`products`, `products` as `p`)
LEFT OUTER JOIN `products_description` as `pd` ON `p`.`products_id` = `pd`.`products_id`
LEFT OUTER JOIN `products_description_ncbi_sp` as `pdns` ON `p`.`products_id` = `pdns`.`products_id`
LEFT OUTER JOIN `products_extra` as `pe` ON `p`.`products_id` = `pe`.`products_id`
WHERE `p`.`products_id` = '29104'
AND `pd`.`language_id` = 1
LIMIT 1
Query
Database
1.93 ms
select p.*, pd.*,
ifnull(pdns.ncbi_summary, 'N/A') as ncbi_summary_pdns,
ifnull(pdns.sp_comments, 'N/A') as sp_comments_pdns,
ifnull(pdns.ncbi_research_articles, 'N/A') as ncbi_research_articles_pdns,
ifnull(pe.products_description_extra, 'N/A') as products_description_extra
from products p
LEFT OUTER JOIN products_description pd on p.products_id = pd.products_id
LEFT OUTER JOIN products_description_ncbi_sp pdns on p.products_id = pdns.products_id
LEFT OUTER JOIN products_extra pe on p.products_id = pe.products_id
where p.products_id = '29104' and pd.language_id = 1
Query
Database
1.71 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '29104'
Database (4 total Queries, 4 of them unique across 2 Connections)
Time
Query String
2.08 ms
SELECT `p`.*, `pd`.*, IFNULL(pdns.ncbi_summary, "N/A") as ncbi_summary_pdns, IFNULL(pdns.sp_comments, "N/A") as sp_comments_pdns, IFNULL(pdns.ncbi_research_articles, "N/A") as ncbi_research_articles_pdns, IFNULL(pe.products_description_extra, "N/A") as products_description_extra
FROM (`products`, `products` as `p`)
LEFT OUTER JOIN `products_description` as `pd` ON `p`.`products_id` = `pd`.`products_id`
LEFT OUTER JOIN `products_description_ncbi_sp` as `pdns` ON `p`.`products_id` = `pdns`.`products_id`
LEFT OUTER JOIN `products_extra` as `pe` ON `p`.`products_id` = `pe`.`products_id`
WHERE `p`.`products_id` = '29104'
AND `pd`.`language_id` = 1
LIMIT 1
select p.*, pd.*,
ifnull(pdns.ncbi_summary, 'N/A') as ncbi_summary_pdns,
ifnull(pdns.sp_comments, 'N/A') as sp_comments_pdns,
ifnull(pdns.ncbi_research_articles, 'N/A') as ncbi_research_articles_pdns,
ifnull(pe.products_description_extra, 'N/A') as products_description_extra
from products p
LEFT OUTER JOIN products_description pd on p.products_id = pd.products_id
LEFT OUTER JOIN products_description_ncbi_sp pdns on p.products_id = pdns.products_id
LEFT OUTER JOIN products_extra pe on p.products_id = pe.products_id
where p.products_id = '29104' and pd.language_id = 1
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '29104'
IHC (Immunohistchemistry)||Dilution: Western Blot: 1/500 - 1/2000. Immunohistochemistry: 1/100 - 1/300. ELISA: 1/5000. Not yet tested in other applications.||AAA29104_IHC6.jpg!!Application Data||Dilution: Western Blot: 1/500 - 1/2000. Immunohistochemistry: 1/100 - 1/300. ELISA: 1/5000. Not yet tested in other applications.||AAA29104_APP5.jpg!!WB (Western Blot)||Dilution: Western Blot: 1/500 - 1/2000. Immunohistochemistry: 1/100 - 1/300. ELISA: 1/5000. Not yet tested in other applications.||AAA29104_WB4.jpg!!IHC (Immunohistochemistry-Paraffin)||Dilution: Western Blot: 1/500 - 1/2000. Immunohistochemistry: 1/100 - 1/300. ELISA: 1/5000. Not yet tested in other applications.||AAA29104_IHC3.jpg!!WB (Western Blot)||Dilution: Western Blot: 1/500 - 1/2000. Immunohistochemistry: 1/100 - 1/300. ELISA: 1/5000. Not yet tested in other applications.||AAA29104_WB2.jpg!!WB (Western Blot)||Dilution: Western Blot: 1/500 - 1/2000. Immunohistochemistry: 1/100 - 1/300. ELISA: 1/5000. Not yet tested in other applications.||AAA29104_WB.jpg
⇄⧉products_name_syn => string (98) "RAB34; RAB39; RAH; Ras-related protein Rab-34; Ras-related protein Rab-39; R...
$value['products_name_syn']
RAB34; RAB39; RAH; Ras-related protein Rab-34; Ras-related protein Rab-39; Ras-related protein Rah
⇄products_gene_name => string (5) "Rab34"
$value['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value['products_gene_name_syn']
⇄⧉products_description => string (406) "Protein transport. Involved in the redistribution of lysosomes to the peri-G...
$value['products_description']
Protein transport. Involved in the redistribution of lysosomes to the peri-Golgi region (By similarity). Plays a role in the maturation of phagosomes that engulf pathogens, such as S.aureus and M.tuberculosis (PubMed:21255211). Plays a role in the fusion of phagosomes with lysosomes (PubMed:21255211). Acts also as a positive regulator of hedgehog signaling and regulates ciliary function (By similarity).
IHC (Immunohistchemistry)||Dilution: Western Blot: 1/500 - 1/2000. Immunohistochemistry: 1/100 - 1/300. ELISA: 1/5000. Not yet tested in other applications.||AAA29104_IHC6.jpg!!Application Data||Dilution: Western Blot: 1/500 - 1/2000. Immunohistochemistry: 1/100 - 1/300. ELISA: 1/5000. Not yet tested in other applications.||AAA29104_APP5.jpg!!WB (Western Blot)||Dilution: Western Blot: 1/500 - 1/2000. Immunohistochemistry: 1/100 - 1/300. ELISA: 1/5000. Not yet tested in other applications.||AAA29104_WB4.jpg!!IHC (Immunohistochemistry-Paraffin)||Dilution: Western Blot: 1/500 - 1/2000. Immunohistochemistry: 1/100 - 1/300. ELISA: 1/5000. Not yet tested in other applications.||AAA29104_IHC3.jpg!!WB (Western Blot)||Dilution: Western Blot: 1/500 - 1/2000. Immunohistochemistry: 1/100 - 1/300. ELISA: 1/5000. Not yet tested in other applications.||AAA29104_WB2.jpg!!WB (Western Blot)||Dilution: Western Blot: 1/500 - 1/2000. Immunohistochemistry: 1/100 - 1/300. ELISA: 1/5000. Not yet tested in other applications.||AAA29104_WB.jpg
⇄⧉products_name_syn => string (98) "RAB34; RAB39; RAH; Ras-related protein Rab-34; Ras-related protein Rab-39; R...
$value->a['products_name_syn']
RAB34; RAB39; RAH; Ras-related protein Rab-34; Ras-related protein Rab-39; Ras-related protein Rah
⇄products_gene_name => string (5) "Rab34"
$value->a['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value->a['products_gene_name_syn']
⇄⧉products_description => string (406) "Protein transport. Involved in the redistribution of lysosomes to the peri-G...
$value->a['products_description']
Protein transport. Involved in the redistribution of lysosomes to the peri-Golgi region (By similarity). Plays a role in the maturation of phagosomes that engulf pathogens, such as S.aureus and M.tuberculosis (PubMed:21255211). Plays a role in the fusion of phagosomes with lysosomes (PubMed:21255211). Acts also as a positive regulator of hedgehog signaling and regulates ciliary function (By similarity).
IHC (Immunohistchemistry)||Dilution: Western Blot: 1/500 - 1/2000. Immunohistochemistry: 1/100 - 1/300. ELISA: 1/5000. Not yet tested in other applications.||AAA29104_IHC6.jpg!!Application Data||Dilution: Western Blot: 1/500 - 1/2000. Immunohistochemistry: 1/100 - 1/300. ELISA: 1/5000. Not yet tested in other applications.||AAA29104_APP5.jpg!!WB (Western Blot)||Dilution: Western Blot: 1/500 - 1/2000. Immunohistochemistry: 1/100 - 1/300. ELISA: 1/5000. Not yet tested in other applications.||AAA29104_WB4.jpg!!IHC (Immunohistochemistry-Paraffin)||Dilution: Western Blot: 1/500 - 1/2000. Immunohistochemistry: 1/100 - 1/300. ELISA: 1/5000. Not yet tested in other applications.||AAA29104_IHC3.jpg!!WB (Western Blot)||Dilution: Western Blot: 1/500 - 1/2000. Immunohistochemistry: 1/100 - 1/300. ELISA: 1/5000. Not yet tested in other applications.||AAA29104_WB2.jpg!!WB (Western Blot)||Dilution: Western Blot: 1/500 - 1/2000. Immunohistochemistry: 1/100 - 1/300. ELISA: 1/5000. Not yet tested in other applications.||AAA29104_WB.jpg
⇄⧉products_name_syn => string (98) "RAB34; RAB39; RAH; Ras-related protein Rab-34; Ras-related protein Rab-39; R...
$value->d['products_name_syn']
RAB34; RAB39; RAH; Ras-related protein Rab-34; Ras-related protein Rab-39; Ras-related protein Rah
⇄products_gene_name => string (5) "Rab34"
$value->d['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value->d['products_gene_name_syn']
⇄⧉products_description => string (406) "Protein transport. Involved in the redistribution of lysosomes to the peri-G...
$value->d['products_description']
Protein transport. Involved in the redistribution of lysosomes to the peri-Golgi region (By similarity). Plays a role in the maturation of phagosomes that engulf pathogens, such as S.aureus and M.tuberculosis (PubMed:21255211). Plays a role in the fusion of phagosomes with lysosomes (PubMed:21255211). Acts also as a positive regulator of hedgehog signaling and regulates ciliary function (By similarity).
⇄⧉specificity => string (187) "This assay has high sensitivity and excellent specificity for detection of h...
$value[0]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of human ST6GAL1. No significant cross-reactivity or interference between human ST6GAL1 and analogues was observed.
⇄purity => string (3) "N/A"
$value[0]['_source']['purity']
⇄form => string (3) "N/A"
$value[0]['_source']['form']
⇄concentration => string (3) "N/A"
$value[0]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[0]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[0]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄⧉products_description => string (743) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[0]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for ST6GAL1 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any ST6GAL1 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for ST6GAL1 is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of ST6GAL1 bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄⧉search_terms => string (933) "aaa18063 human this assay has high sensitivity and excellent specificity for...
$value[0]['_source']['search_terms']
aaa18063 human this assay has high sensitivity and excellent specificity for detection of st6gal1 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa18063_td elisa kit st6 beta galactosamide alpha 2 6 sialyltranferase 1 galactoside sialyltransferase mgc48859 siat1 st6gali st6n cmp n acetylneuraminate otthump00000210002 st6gal i st sialyl 2,6 isoform a b cell antigen cd75 46,605 da siat1_human 4506949 np_003023.1 p15907 nm_003032.2 a8ka14 d3dnv3 109675 samples serum plasma culture supernates tissue homogenates type sandwich range 3.9 ng ml 250 the minimum detectable dose is typically less than 0.97 lower limit lld defined as lowest protein concentration that could be differentiated from zero it determined mean o.d value 20 replicates added by their three deviations intra precision within an cv alpha2 sialyltranferase1 range3.9 ml250 value20
⇄⧉products_description => string (709) "Intended Uses: This PDGFRbeta ELISA kit is intended Laboratory for Research ...
$value[1]['_source']['products_description']
Intended Uses: This PDGFRbeta ELISA kit is intended Laboratory for Research use only and is not for use in diagnostic or therapeutic procedures. The Stop Solution changes the color from blue to yellow and the intensity of the color is measured at 450 nm using a spectrophotometer. In order to measure the concentration of PDGFRbeta in the sample, this PDGFRbeta ELISA Kit includes a set of calibration standards. The calibration standards are assayed at the same time as the samples and allow the operator to produce a standard curve of Optical Density versus PDGFRbeta concentration. The concentration of PDGFRbeta in the samples is then determined by comparing the O.D. of the samples to the standard curve.
⇄⧉ncbi_pathways => string (436) "ARMS-mediated Activation Pathway||1324638!!Adaptive Immune System Pathway||1...
$value[1]['_source']['ncbi_pathways']
ARMS-mediated Activation Pathway||1324638!!Adaptive Immune System Pathway||1323640!!Axon Guidance Pathway||1323598!!Calcium Signaling Pathway||83247!!Calcium Signaling Pathway||459!!Central Carbon Metabolism In Cancer Pathway||1060315!!Central Carbon Metabolism In Cancer Pathway||1084231!!Choline Metabolism In Cancer Pathway||1060314!!Choline Metabolism In Cancer Pathway||1084232!!Cytokine Signaling In Immune System Pathway||1323763
⇄⧉search_terms => string (461) "aaa23747 mouse typical testing data standard curve for reference only aaa237...
$value[1]['_source']['search_terms']
aaa23747 mouse typical testing data standard curve for reference only aaa23747_sc elisa kit platelet derived growth factor receptor beta isoform 1 polypeptide pdgfrb pdgfr cd140b ai528809 type cd140 antigen like family member b cd_antigen pdgfr1 pdgf r pgfrb_mouse 226342982 np_001139740.1 p05622 samples serum plasma cell culture supernate and other biological fluids assay sandwich detection range 250 pg ml 4000 sensitivity 10 isoform1 range250 sensitivity10
⇄⧉testing_protocols => string (3215) "WB (Western Blot)||Western blot analysis of Catenin-gamma expression in mous...
$value[2]['_source']['testing_protocols']
WB (Western Blot)||Western blot analysis of Catenin-gamma expression in mouse tissue extract||AAA31082_WB12.jpg!!IHC (Immunohistochemistry)||Catenin-gamma Antibody for IHC in human colon tissue.||AAA31082_IHC11.jpg!!IHC (Immunohistochemistry)||Catenin-gamma Antibody for IHC in human colon tissue.||AAA31082_IHC10.jpg!!IHC (Immunohistchemistry)||AAA31082 at 1/200 staining human breast cancer tissue sections by IHC-P. The tissue was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The tissue was then blocked and incubated with the antibody for 1.5 hours at 22 degree C. An HRP conjugated goat anti-rabbit antibody was used as the secondary.||AAA31082_IHC9.jpg!!IHC (Immunohistochemistry)||AAA31082 at 1/50 staining human colon cancer tissue sections by IHC-P. The tissue was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The tissue was then blocked and incubated with the antibody for 1.5 hours at 22 degree C. An HRP conjugated goat anti-rabbit antibody was used as the secondary.||AAA31082_IHC8.jpg!!WB (Western Blot)||Western blot analysis of extracts from rat brain, mouse spleen, using Catenin-gamma Antibody.||AAA31082_WB7.jpg!!IF (Immunofluorescence)||AAA31082 staining HeLa by IF/ICC. The sample were fixed with PFA and permeabilized in 0.1% Triton X-100, then blocked in 10% serum for 45 minutes at 25 degree C. The primary antibody was diluted at 1/200 and incubated with the sample for 1 hour at 37 degree C. An Alexa Fluor 594 conjugated goat anti-rabbit IgG (H+L) Ab, diluted at 1/600, was used as the secondary antibody.||AAA31082_IF6.jpg!!IHC (Immunohistochemistry)||AAA31082 at 1/200 staining human colon cancer tissue sections by IHC-P. The tissue was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The tissue was then blocked and incubated with the antibody for 1.5 hours at 22 degree C. An HRP conjugated goat anti-rabbit antibody was used as the secondary.||AAA31082_IHC5.jpg!!IHC (Immunohistochemistry)||AAA31082 at 1/200 staining human colon cancer tissue sections by IHC-P. The tissue was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The tissue was then blocked and incubated with the antibody for 1.5 hours at 22 degree C. An HRP conjugated goat anti-rabbit antibody was used as the secondary.||AAA31082_IHC4.jpg!!IHC (Immunohistochemistry)||AAA31082 at 1/200 staining human colon cancer tissue sections by IHC-P. The tissue was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The tissue was then blocked and incubated with the antibody for 1.5 hours at 22 degree C. An HRP conjugated goat anti-rabbit antibody was used as the secondary.||AAA31082_IHC3.jpg!!IHC (Immunohistochemistry)||AAA31082 at 1/200 staining human breast cancer tissue sections by IHC-P. The tissue was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The tissue was then blocked and incubated with the antibody for 1.5 hours at 22 degree C. An HRP conjugated goat anti-rabbit antibody was used as the secondary.||AAA31082_IHC2.jpg
⇄⧉etc_term1 => string (438) "Immunogen||A synthesized peptide derived from human Catenin-gamma!!Subcellul...
$value[2]['_source']['etc_term1']
Immunogen||A synthesized peptide derived from human Catenin-gamma!!Subcellular Location||Cell Junction > Adherens Junction. Cell Junction > Desmosome. Cytoplasm > Cytoskeleton. Membrane. Cytoplasmic in a soluble and membrane-associated form.!!<font color="black">Predicted Cross Reactivity</font>||<b>Pig, Bovine, Sheep, Rabbit, Dog, Xenopus</b>!!Similarity||Pig (92%), Bovine (92%), Sheep (100%), Rabbit (100%), Dog (100%), Xenopus (80%)
⇄⧉products_description => string (1581) "Function: Common junctional plaque protein. The membrane-associated plaques ...
$value[2]['_source']['products_description']
Function: Common junctional plaque protein. The membrane-associated plaques are architectural elements in an important strategic position to influence the arrangement and function of both the cytoskeleton and the cells within the tissue. The presence of plakoglobin in both the desmosomes and in the intermediate junctions suggests that it plays a central role in the structure and function of submembranous plaques. Acts as a substrate for VE-PTP and is required by it to stimulate VE-cadherin function in endothelial cells. Can replace beta-catenin in E-cadherin/catenin adhesion complexes which are proposed to couple cadherins to the actin cytoskeleton (By similarity).<br>Subunit Structure: Homodimer. Component of an E-cadherin/catenin adhesion complex composed of at least E-cadherin/CDH1 and gamma-catenin/JUP, and possibly alpha-catenin/CTNNA1; the complex is located to adherens junctions. The stable association of CTNNA1 is controversial as CTNNA1 was shown not to bind to F-actin when assembled in the complex. Interacts with MUC1. Interacts with CAV1 (By similarity). Interacts with PTPRJ. Interacts with DSG1. Interacts with DSC1 and DSC2. Interacts with PKP2.<br>Post-translational Modifications: May be phosphorylated by FER.<br>Similarity: The entire ARM repeats region mediates binding to CDH1/E-cadherin. The N-terminus and first three ARM repeats are sufficient for binding to DSG1. The N-terminus and first ARM repeat are sufficient for association with CTNNA1. DSC1 association requires both ends of the ARM repeat region. Belongs to the beta-catenin family.
⇄⧉specificity => string (382) "This assay has high sensitivity and excellent specificity for detection of A...
$value[3]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of AKR1C2. No significant cross-reactivity or interference between AKR1C2 and analogues was observed. NOTE: Limited by current skills and knowledge, it is impossible for us to complete the cross-reactivity detection between AKR1C2 and all the analogues, therefore, cross reaction may still exist in some cases.
⇄purity => string (3) "N/A"
$value[3]['_source']['purity']
⇄form => string (3) "N/A"
$value[3]['_source']['form']
⇄concentration => string (3) "N/A"
$value[3]['_source']['concentration']
⇄storage_stability => string (35) "Store all reagents at 2-8 degree C."
Assay Type||Quantitative Competitive!!Samples||Serum, plasma, cell culture supernatants, body fluid and tissue homogenate!!Sensitivity||0.1 ng/ml
⇄etc_term2 => string (3) "N/A"
$value[3]['_source']['etc_term2']
⇄products_price => string (6) "0.0000"
$value[3]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[3]['_source']['products_weight']
⇄products_status => boolean true
$value[3]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[3]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "720"
$value[3]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[3]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[3]['_source']['language_id']
⇄products_name => string (47) "Aldo keto reductase family 1 member C2 (AKR1C2)"
$value[3]['_source']['products_name']
⇄products_name_oem => string (63) "Human Aldo keto reductase family 1 member C2 (AKR1C2) ELISA Kit"
$value[3]['_source']['products_name_oem']
⇄products_name_syn => string (3) "N/A"
$value[3]['_source']['products_name_syn']
⇄products_gene_name => string (6) "AKR1C2"
$value[3]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[3]['_source']['products_gene_name_syn']
⇄⧉products_description => string (1415) "Principle of the Assay: AKR1C2 ELISA kit applies the competitive enzyme immu...
$value[3]['_source']['products_description']
Principle of the Assay: AKR1C2 ELISA kit applies the competitive enzyme immunoassay technique utilizing a polyclonal anti-AKR1C2 antibody and an AKR1C2-HRP conjugate. The assay sample and buffer are incubated together with AKR1C2-HRP conjugate in pre-coated plate for one hour. After the incubation period, the wells are decanted and washed five times. The wells are then incubated with a substrate for HRP enzyme. The product of the enzyme-substrate reaction forms a blue colored complex. Finally, a stop solution is added to stop the reaction, which will then turn the solution yellow. The intensity of color is measured spectrophotometrically at 450nm in a microplate reader. The intensity of the color is inversely proportional to the AKR1C2 concentration since AKR1C2 from samples and AKR1C2-HRP conjugate compete for the anti-AKR1C2 antibody binding site. Since the number of sites is limited, as more sites are occupied by AKR1C2 from the sample, fewer sites are left to bind AKR1C2-HRP conjugate. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The AKR1C2 concentration in each sample is interpolated from this standard curve.<br><br>Intended Uses: This AKR1C2 ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Human AKR1C2. This ELISA kit for research use only, not for therapeutic or diagnostic applications!
⇄⧉ncbi_protein_info => string (361) "aldo-keto reductase family 1 member C2; DD-2; DD/BABP; 3-alpha-HSD3; pseudo-...
$value[3]['_source']['ncbi_protein_info']
aldo-keto reductase family 1 member C2; DD-2; DD/BABP; 3-alpha-HSD3; pseudo-chlordecone reductase; type II dihydrodiol dehydrogenase; chlordecone reductase homolog HAKRD; testicular 17,20-desmolase deficiency; trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III
⇄ncbi_chrom_loc => string (3) "N/A"
$value[3]['_source']['ncbi_chrom_loc']
⇄ncbi_gene_id => string (4) "1646"
$value[3]['_source']['ncbi_gene_id']
⇄ncbi_mol_weight => string (9) "15,748 Da"
$value[3]['_source']['ncbi_mol_weight']
⇄⧉ncbi_pathways => string (466) "Benzo(a)pyrene Metabolism Pathway||198911!!Bile Acid And Bile Salt Metabolis...
$value[3]['_source']['ncbi_pathways']
Benzo(a)pyrene Metabolism Pathway||198911!!Bile Acid And Bile Salt Metabolism Pathway||106144!!Chemical Carcinogenesis Pathway||673221!!Chemical Carcinogenesis Pathway||673237!!Metabolism Pathway||477135!!Metabolism Of Lipids And Lipoproteins Pathway||160976!!Metabolism Of Xenobiotics By Cytochrome P450 Pathway||83031!!Metabolism Of Xenobiotics By Cytochrome P450 Pathway||425!!Steroid Hormone Biosynthesis Pathway||82940!!Steroid Hormone Biosynthesis Pathway||301
⇄sp_protein_name => string (38) "Aldo-keto reductase family 1 member C2"
⇄⧉specificity => string (183) "This assay has high sensitivity and excellent specificity for detection of h...
$value[4]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of human PEBP1. No significant cross-reactivity or interference between human PEBP1 and analogues was observed.
⇄purity => string (3) "N/A"
$value[4]['_source']['purity']
⇄form => string (3) "N/A"
$value[4]['_source']['form']
⇄concentration => string (3) "N/A"
$value[4]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[4]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[4]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄products_price => string (6) "0.0000"
$value[4]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[4]['_source']['products_weight']
⇄products_status => boolean true
$value[4]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[4]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "700"
$value[4]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[4]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[4]['_source']['language_id']
⇄products_name => string (42) "phosphatidylethanolamine binding protein 1"
Human Phosphatidylethanolamine-binding protein 1 (PEBP1) ELISA kit; HCNP; PBP; PEBP; RKIP; Raf kinase inhibitory protein; hippocampal cholinergic neurostimulating peptide; prostatic binding protein; phosphatidylethanolamine binding protein 1
⇄products_gene_name => string (5) "PEBP1"
$value[4]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[4]['_source']['products_gene_name_syn']
⇄⧉products_description => string (735) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[4]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for PEBP1 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any PEBP1 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for PEBP1 is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of PEBP1 bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄products_references => string (3) "N/A"
$value[4]['_source']['products_references']
⇄⧉products_related_diseases => string (224) "Neoplasms||82!!Skin Diseases||18!!Nervous System Diseases||8!!Liver Diseases...
$value[4]['_source']['products_related_diseases']
Neoplasms||82!!Skin Diseases||18!!Nervous System Diseases||8!!Liver Diseases||8!!Central Nervous System Diseases||7!!Carcinoma, Hepatocellular||6!!Immune System Diseases||6!!Liver Neoplasms||6!!Brain Diseases||6!!Necrosis||6
⇄products_categories => string (3) "N/A"
$value[4]['_source']['products_categories']
⇄ncbi_full_name => string (56) "phosphatidylethanolamine-binding protein 1 preproprotein"
$value[4]['_source']['ncbi_full_name']
⇄ncbi_full_name_syn => string (42) "phosphatidylethanolamine binding protein 1"
⇄⧉search_terms => string (705) "aaa18027 human this assay has high sensitivity and excellent specificity for...
$value[4]['_source']['search_terms']
aaa18027 human this assay has high sensitivity and excellent specificity for detection of pebp1 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa18027_td elisa kit phosphatidylethanolamine binding protein 1 hcnp pbp pebp rkip raf kinase inhibitory hippocampal cholinergic neurostimulating peptide prostatic preproprotein hcnppp hel 210 s 34 neuropolypeptide h3 inhibitor epididymis luminal secretory li 21,057 da pebp1_human 4505621 np_002558.1 p30086 nm_002567.2 b2r4s1 604591 samples serum plasma cell lysates type quantitative sandwich range 0.156 ng ml 10 < 0.039 intra precision within an cv protein1 hel210 s34 ml10
Immunohistochemistry (IHC - Paraffin), Immunofluorescence (IF), Western Blot (WB), ELISA (EIA)
⇄⧉app_notes => string (285) "ELISA, IF (10 ug/ml), IHC-P (5 ug/ml), WB<br>Usage: Western Blot (Cell lysat...
$value[5]['_source']['app_notes']
ELISA, IF (10 ug/ml), IHC-P (5 ug/ml), WB<br>Usage: Western Blot (Cell lysate) - positive control A-431. Western Blot (Transfected lysate) - positive control transfected 293T cell line. Immunofluorescence (10 ug/ml) - positive control A-431 cells. Sandwich ELISA (Recombinant protein).
⇄⧉testing_protocols => string (977) "ELISA||Detection limit for recombinant GST tagged JUP is approximately 1 ng/...
$value[5]['_source']['testing_protocols']
ELISA||Detection limit for recombinant GST tagged JUP is approximately 1 ng/ml as a capture antibody.||AAA12352_ELISA6.jpg!!WB (Western Blot)||JUP monoclonal antibody clone 1D5 Western blot of JUP expression in A-431.||AAA12352_WB5.jpg!!WB (Western Blot)||Western blot of JUP expression in transfected 293T cell line by JUP monoclonal antibody clone 2G9.||AAA12352_WB4.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to JUP on A-431 cell (antibody concentration 10 ug/ml).||AAA12352_IF3.jpg!!IHC (Immunohistochemistry)||Anti-Gamma Catenin antibody IHC of human uterus. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.||AAA12352_IHC2.jpg!!IHC (Immunohistochemistry)||Anti-Gamma Catenin antibody IHC of human breast. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.||AAA12352_IHC.jpg
Target Species||Human!!Immunogen Description||JUP (AAH11865, 1 a.a. ~ 746 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen Type||Recombinant protein!!Immunogen||JUP/CTNNG/Junction Plakoglobin antibody was raised against jUP (AAH11865, 1 a.a. ~ 746 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
⇄⧉search_terms => string (979) "aaa12352 mouse human monoclonal igg1,k 2g9 protein a purified pbs ph 7.4 imm...
$value[5]['_source']['search_terms']
aaa12352 mouse human monoclonal igg1,k 2g9 protein a purified pbs ph 7.4 immunohistochemistry ihc paraffin immunofluorescence if western blot wb elisa eia 10 ug ml p 5 usage cell lysate positive control 431 transfected 293t line cells sandwich recombinant anti gamma catenin antibody of breast formalin fixed embedded tissue after heat induced antigen retrieval concentration aaa12352_ihc uterus aaa12352_ihc2 to jup on aaa12352_if3 expression in by clone aaa12352_wb4 1d5 aaa12352_wb5 detection limit for gst tagged is approximately 1 ng as capture aaa12352_el6 ctnng junction plakoglobin plus desmoplakin 3 dpiii pkgb arvd12 iii dp3 pdgb cadherin associated 80kda 81,745 da plak_human 4504811 np_002221.1 p14923 nm_002230.2 q15093 q15151 q7l3s5 q86w21 q9bwc4 q9hcx9 phenotype 611528 family target species immunogen description aah11865 a.a ~ 746 full length with tag mw the alone 26 kda type was raised against ph7.4 eia10 p5 control431 approximately1 desmoplakin3 ~746 alone26
Human Aminoacyl tRNA synthase complex interacting multifunctional protein 1 (SCYE1) ELISA Kit
⇄products_name_syn => string (3) "N/A"
$value[6]['_source']['products_name_syn']
⇄products_gene_name => string (5) "SCYE1"
$value[6]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[6]['_source']['products_gene_name_syn']
⇄⧉products_description => string (1354) "Intended Uses: This SCYE1 ELISA kit is a 1.5 hour solid-phase ELISA designed...
$value[6]['_source']['products_description']
Intended Uses: This SCYE1 ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Human SCYE1. This ELISA kit for research use only!<br><br>Principle of the Assay: SCYE1 ELISA kit applies the competitive enzyme immunoassay technique utilizing a polyclonal anti-SCYE1 antibody and an SCYE1-HRP conjugate. The assay sample and buffer are incubated together with SCYE1-HRP conjugate in pre-coated plate for one hour. After the incubation period, the wells are decanted and washed five times. The wells are then incubated with a substrate for HRP enzyme. The product of the enzyme-substrate reaction forms a blue colored complex. Finally, a stop solution is added to stop the reaction, which will then turn the solution yellow. The intensity of color is measured spectrophotometrically at 450nm in a microplate reader. The intensity of the color is inversely proportional to the SCYE1 concentration since SCYE1 from samples and SCYE1-HRP conjugate compete for the anti-SCYE1 antibody binding site. Since the number of sites is limited, as more sites are occupied by SCYE1 from the sample, fewer sites are left to bind SCYE1-HRP conjugate. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The SCYE1 concentration in each sample is interpolated from this standard curve.
⇄⧉sp_protein_name_syn => string (253) "Multisynthase complex auxiliary component p43Cleaved into the following chai...
$value[6]['_source']['sp_protein_name_syn']
Multisynthase complex auxiliary component p43Cleaved into the following chain:Endothelial monocyte-activating polypeptide 2; EMAP-2Alternative name(s):Endothelial monocyte-activating polypeptide II; EMAP-II; Small inducible cytokine subfamily E member 1
⇄⧉search_terms => string (714) "aaa27202 human typical standard curve testing data aaa27202_td elisa kit ami...
$value[6]['_source']['search_terms']
aaa27202 human typical standard curve testing data aaa27202_td elisa kit aminoacyl trna synthase complex interacting multifunctional protein 1 scye1 isoform b synthetase aimp1 p43 hld3 emap2 emapii ars endothelial monocyte activating polypeptide 2 multisynthase auxiliary component ii multisynthetase small inducible cytokine subfamily e member 37,039 da p43cleaved into the following chain:endothelial emap 2alternative name s aimp1_human 215490011 np_001135888.1 q12904 nm_001142416.1 q6fg28 q96cq9 b3ktr2 b4e1s7 603605 immunology samples serum plasma cell culture supernatants body fluid and tissue homogenate assay type competitive detection range 250 5000pg ml sensitivity 1.0pg protein1 polypeptide2 range250
⇄⧉testing_protocols => string (1300) "FCM (Flow Cytometry)||Flow cytometric analysis of Hela cells with gamma Cate...
$value[7]['_source']['testing_protocols']
FCM (Flow Cytometry)||Flow cytometric analysis of Hela cells with gamma Catenin antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody||AAA30273_FCM6.jpg!!ICC (Immunocytochemistry)||ICC staining gamma Catenin in A431 cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.||AAA30273_ICC5.jpg!!ICC (Immunocytochemistry)||ICC staining gamma Catenin in MCF-7 cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.||AAA30273_ICC4.jpg!!ICC (Immunocytochemistry)||ICC staining gamma Catenin in Hela cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.||AAA30273_ICC3.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded mouse stomach tissue using anti-gamma Catenin antibody. Counter stained with hematoxylin.||AAA30273_IHC2.jpg!!WB (Western Blot)||Western blot analysis of gamma Catenin on Hela cells lysates using anti-gamma Catenin antibody at 1/1, 000 dilution.||AAA30273_WB.jpg
⇄⧉products_description => string (862) "The catenins, alpha, beta and gamma, are proteins which bind to the highly c...
$value[7]['_source']['products_description']
The catenins, alpha, beta and gamma, are proteins which bind to the highly conserved, intracellular cytoplasmic tail of E-cadherin. Together, the catenin/cadherin complexes play an important role mediating cellular adhesion. alpha-catenin was initially described as an E-cadherin associated protein, and since has been shown to associate with other members of the cadherin family, such as N-cadherin and P-cadherin. beta-catenin associates with the cytoplasmic portion of E-cadherin, which is necessary for the function of E-cadherin as an adhesion molecule. beta-catenin has also been found in complexes with the tumor suppressor protein APC. gamma-catenin, also known as plakoglobin, binds with alpha-catenin and N-cadherin. It has been shown that the transmembrane phosphatase PTP associates with catenin/cadherin complexes and may regulate complex signaling.
⇄⧉search_terms => string (1215) "aaa30273 rabbit human mouse rat monoclonal jf0973 proa affinity purified 1*t...
$value[7]['_source']['search_terms']
aaa30273 rabbit human mouse rat monoclonal jf0973 proa affinity purified 1*tbs ph7.4 1 bsa 40 glycerol preservative 0.05 sodium azide western blot wb immunocytochemistry icc immunofluorescence if immunohistochemistry ihc flow cytometry fc facs 1:1000 1:2000 1:50 1:200 1:100 1:500 analysis of gamma catenin on hela cells lysates using anti antibody at 000 dilution aaa30273_wb immunohistochemical paraffin embedded stomach tissue counter stained with hematoxylin aaa30273_ihc2 staining in red the nuclear stain is dapi blue were fixed paraformaldehyde permeabilised 0.25 triton x100 pbs aaa30273_icc3 mcf 7 aaa30273_icc4 a431 aaa30273_icc5 cytometric 50 compared an unlabelled control without incubation primary black alexa fluor 488 conjugated goat igg was used as secondary aaa30273_fc6 arvd 12 arvd12 cadherin associated protein 80kda 80kd ctnng desmoplakin 3 iii desmoplakin3 desmoplakiniii dp dp3 dpiii junction plakoglobin jup otthump00000164732 otthump00000164735 otthump00000164738 pdgb pkgb plak_human 81,745 da 4504811 np_002221.1 p14923 nm_002230.2 q15093 q15151 q7l3s5 q86w21 q9bwc4 q9hcx9 173325 total ab type recombinant immunogen conjugation unconjugated ph7.41 bsa40 at000 mcf7 cytometric50 fluor488
⇄purity => string (28) "Protein A & Antigen Affinity"
$value[8]['_source']['purity']
⇄form => string (38) "Liquid; 0.2um filtered solution in PBS"
$value[8]['_source']['form']
⇄concentration => string (3) "N/A"
$value[8]['_source']['concentration']
⇄⧉storage_stability => string (261) "This antibody can be stored at 2-8 degree C for one month without detectable...
$value[8]['_source']['storage_stability']
This antibody can be stored at 2-8 degree C for one month without detectable loss of activity. Antibody products are stable for twelve months from date of receipt when stored at -20 degree C to -80 degree C. Preservative-Free. Avoid repeated freeze-thaw cycles.
⇄⧉testing_protocols => string (1069) "IHC (Immunohistchemistry)||Immunochemical staining KRT1 in rat skin with rab...
$value[8]['_source']['testing_protocols']
IHC (Immunohistchemistry)||Immunochemical staining KRT1 in rat skin with rabbit polyclonal antibody (1:2000, formalin-fixed paraffin embedded sections).||AAA27717_IHC6.png!!IHC (Immunohistochemistry)||Immunochemical staining KRT1 in mouse skin with rabbit polyclonal antibody (1:2000, formalin-fixed paraffin embedded sections).||AAA27717_IHC5.png!!IHC (Immunohistochemistry)||Immunochemical staining KRT1 in human hepatoma with rabbit polyclonal antibody (1:500, formalin-fixed paraffin embedded sections).||AAA27717_IHC4.png!!IHC (Immunohistochemistry)||Immunochemical staining KRT1 in human malignant melanoma with rabbit polyclonal antibody (1:2000, formalin-fixed paraffin embedded sections).||AAA27717_IHC3.png!!IHC (Immunohistochemistry)||Immunochemical staining KRT1 in human skin with rabbit polyclonal antibody (1:2000, formalin-fixed paraffin embedded sections).||AAA27717_IHC2.png!!IHC (Immunohistochemistry)||Immunochemical staining KRT1 in human stomach with rabbit polyclonal antibody (1:500, formalin-fixed paraffin embedded sections).||AAA27717_IHC.png
⇄⧉etc_term1 => string (107) "Immunogen||A synthetic peptide corresponding to the N-terminus of the Human ...
$value[8]['_source']['etc_term1']
Immunogen||A synthetic peptide corresponding to the N-terminus of the Human KRT1!!Conjugation||Unconjugated
⇄⧉etc_term2 => string (167) "Preparation||Produced in rabbits immunized with a synthetic peptide correspo...
$value[8]['_source']['etc_term2']
Preparation||Produced in rabbits immunized with a synthetic peptide corresponding to the N-terminus of the Human KRT1, and purified by antigen affinity chromatography.
⇄⧉products_description => string (766) "KRT1 (Keratin 1) is a Protein Coding gene. The protein encoded by this gene ...
$value[8]['_source']['products_description']
KRT1 (Keratin 1) is a Protein Coding gene. The protein encoded by this gene is a member of the keratin gene family. It belongs to the intermediate filament family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. Mutations in the KRT1 gene underlie epidermolytic hyperkeratosis (EHK). This autosomal dominant disorder is characterized by phenotypic heterogeneity. Epidermolytic hyperkeratosis is a rare autosomal dominant inherited skin disorder caused by keratin 1 or keratin 10 mutations. Diseases associated with KRT1 include Palmoplantar Keratoderma, Nonepidermolytic and Ichthyosis Hystrix, Curth-Macklin Type.
Assay Type||Quantitative Sandwich!!Samples||Serum, plasma, cell culture supernates, Ascites, tissue homogenates or other biological fluids!!Detection Range||0.2-70ng/ml!!Sensitivity||0.092ng/ml
⇄⧉etc_term2 => string (403) "Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Thr...
$value[9]['_source']['etc_term2']
Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Three samples of known concentration were tested on one plate to assess intra-assay precision. Intra-Assay: CV<8%!!Inter-assay Precision||Inter-Assay Precision (Precision between assays) Three samples of known concentration were tested in separate assays to assess inter-assay precision. CV(%) = SD/mean x 100. Inter-Assay: CV<10%
⇄⧉products_description => string (885) "Principle of the Assay: This kit is an Enzyme-Linked Immunosorbent Assay (EL...
$value[9]['_source']['products_description']
Principle of the Assay: This kit is an Enzyme-Linked Immunosorbent Assay (ELISA). The plate has been pre-coated with Fish ACE antibody. ACE present in the sample is added and binds to antibodies coated on the wells. And then biotinylated Fish ACE Antibody is added and binds to ACE in the sample. Then Streptavidin-HRP is added and binds to the Biotinylated ACE antibody. After incubation unbound Streptavidin-HRP is washed away during a washing step. Substrate solution is then added and color develops in proportion to the amount of Fish ACE. The reaction is terminated by addition of acidic stop solution and absorbance is measured at 450 nm.<br><br>Intended Uses: This sandwich kit is for the accurate quantitative detection of Fish Angiotensin converting enzyme (also known as ACE) in serum, plasma, cell culture supernates, Ascites, tissue homogenates or other biological fluids.
⇄products_references => string (3) "N/A"
$value[9]['_source']['products_references']
⇄products_related_diseases => string (61) "Nervous System Diseases||3!!Eye Neoplasms||1!!Inflammation||1"
⇄⧉search_terms => string (519) "aaa11311 fish typical testing data standard curve for reference only aaa1131...
$value[9]['_source']['search_terms']
aaa11311 fish typical testing data standard curve for reference only aaa11311_sc elisa kit angiotensin converting enzyme ace isoform b ance anon est:fe3d10 bg:ds08220.3 br31 cg8827 dmelcg8827 l 2 34eb l34eb race 70,914 da dipeptidyl carboxypeptidase i kininase ii 24584232 np_723852.1 q10714 nm_165070.3 q27572 q9nke4 q9tx66 q9vjv3 a4v0p3 samples serum plasma cell culture supernates lysates tissue homogenates assay type quantitative sandwich detection range 0.2ng ml 70ng sensitivity 0.092ng intra cv<8 inter cv<10 l2
⇄⧉specificity => string (183) "This assay has high sensitivity and excellent specificity for detection of m...
$value[10]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of mouse LAMP2. No significant cross-reactivity or interference between mouse LAMP2 and analogues was observed.
⇄purity => string (3) "N/A"
$value[10]['_source']['purity']
⇄form => string (3) "N/A"
$value[10]['_source']['form']
⇄concentration => string (3) "N/A"
$value[10]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[10]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[10]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄products_price => string (6) "0.0000"
$value[10]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[10]['_source']['products_weight']
⇄products_status => boolean true
$value[10]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[10]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "700"
$value[10]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[10]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[10]['_source']['language_id']
⇄products_name => string (39) "lysosomal-associated membrane protein 2"
Mouse Lysosome-associated membrane glycoprotein 2 (LAMP2) ELISA kit; CD107b; LAMPB; LGP110; lysosome-associated membrane protein 2; lysosomal-associated membrane protein 2
⇄products_gene_name => string (5) "LAMP2"
$value[10]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[10]['_source']['products_gene_name_syn']
⇄⧉products_description => string (735) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[10]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for LAMP2 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any LAMP2 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for LAMP2 is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of LAMP2 bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄products_references => string (3) "N/A"
$value[10]['_source']['products_references']
⇄⧉products_related_diseases => string (221) "Nervous System Diseases||68!!Heart Diseases||52!!Cardiomyopathies||48!!Glyco...
lysosome-associated membrane glycoprotein 2; lysosomal membrane glycoprotein 2; CD107 antigen-like family member B; lysosomal membrane glycoprotein type B
⇄⧉search_terms => string (754) "aaa18109 mouse this assay has high sensitivity and excellent specificity for...
$value[10]['_source']['search_terms']
aaa18109 mouse this assay has high sensitivity and excellent specificity for detection of lamp2 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa18109_td elisa kit lysosomal associated membrane protein 2 lysosome glycoprotein cd107b lampb lgp110 isoform 1 mac3 lgp b lamp ii 2a 2b 2c cd107 antigen like family member type 45,681 da cd_antigen lamp2_mouse 63054837 np_001017959.1 p17047 nm_001017959.2 q3txg5 q8bsg8 a2a430 samples serum plasma tissue homogenates cell lysates quantitative sandwich range 31.25 pg ml 2000 < 7.81 intra precision within an cv <8 three known concentration were tested twenty times on one plate to assess inter assays <10 in protein2 isoform1
⇄⧉testing_protocols => string (1354) "IF (Immunofluorescence)||Immunofluorescence analysis of NIH/3T3 cells using ...
$value[11]['_source']['testing_protocols']
IF (Immunofluorescence)||Immunofluorescence analysis of NIH/3T3 cells using HLA-DPB1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.||AAA28352_IF7.jpg!!IF (Immunofluorescence)||Immunofluorescence analysis of HeLa cells using HLA-DPB1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.||AAA28352_IF6.jpg!!IF (Immunofluorescence)||Immunofluorescence analysis of C6 cells using HLA-DPB1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.||AAA28352_IF5.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded Rat spleen using HLA-DPB1 antibody at dilution of 1:100 (40x lens).||AAA28352_IHC4.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded Mouse spleen using HLA-DPB1 antibody at dilution of 1:100 (40x lens).||AAA28352_IHC3.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded Human liver cancer using HLA-DPB1 antibody at dilution of 1:100 (40x lens).||AAA28352_IHC2.jpg!!WB (Western Blot)||Western blot analysis of extracts of various cell lines, using HLA-DPB1 antibody at 1:1000 dilution.<br />Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.<br />Lysates/proteins: 25ug per lane.<br />Blocking buffer: 3% nonfat dry milk in TBST.<br />Detection: ECL Basic Kit (RM00020).<br />Exposure time: 1s.||AAA28352_WB.jpg
⇄⧉etc_term1 => string (316) "Immunogen||Recombinant fusion protein of Human HLA-DPB1.!!Cellular Location|...
$value[11]['_source']['etc_term1']
Immunogen||Recombinant fusion protein of Human HLA-DPB1.!!Cellular Location||Cell membrane, Endoplasmic reticulum membrane, Endosome membrane, Golgi apparatus, Lysosome membrane, Single-pass type I membrane protein, trans-Golgi network membrane!!Positive Samples||U-937, A-549, Mouse spleen, Mouse thymus, Rat thymus
DPB1; HLA-DP; HLA-DP1B; HLA-DPB; HLA-DPB1; major histocompatibility complex; class II; DP beta 1
⇄products_gene_name => string (8) "HLA-DPB1"
$value[11]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[11]['_source']['products_gene_name_syn']
⇄⧉products_description => string (863) "Background: HLA-DPB belongs to the HLA class II beta chain paralogues. This ...
$value[11]['_source']['products_description']
Background: HLA-DPB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DPA) and a beta chain (DPB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DP molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to 4 different molecules. [provided by RefSeq, Jul 2008]
⇄products_references => string (3) "N/A"
$value[11]['_source']['products_references']
⇄⧉products_related_diseases => string (210) "Lung Diseases, Interstitial||54!!Nervous System Diseases||50!!Berylliosis||3...
⇄⧉ncbi_protein_info => string (255) "HLA class II histocompatibility antigen, DP beta 1 chain; MHC HLA DPB1; HLA ...
$value[11]['_source']['ncbi_protein_info']
HLA class II histocompatibility antigen, DP beta 1 chain; MHC HLA DPB1; HLA DP14-beta chain; MHC class II HLA-DRB1; class II HLA beta chain; MHC class II antigen DPB1; MHC class II HLA-DP-beta-1; MHC class II antigen DPbeta1; MHC class II antigen beta cha
⇄ncbi_chrom_loc => string (3) "N/A"
$value[11]['_source']['ncbi_chrom_loc']
⇄ncbi_gene_id => string (4) "3115"
$value[11]['_source']['ncbi_gene_id']
⇄ncbi_mol_weight => string (3) "258"
$value[11]['_source']['ncbi_mol_weight']
⇄⧉ncbi_pathways => string (375) "Adaptive Immune System Pathway||366160!!Allograft Rejection Pathway||920963!...
$value[11]['_source']['ncbi_pathways']
Adaptive Immune System Pathway||366160!!Allograft Rejection Pathway||920963!!Allograft Rejection Pathway||83123!!Allograft Rejection Pathway||535!!Antigen Processing And Presentation Pathway||83074!!Antigen Processing And Presentation Pathway||485!!Asthma Pathway||83120!!Asthma Pathway||532!!Autoimmune Thyroid Disease Pathway||83121!!Autoimmune Thyroid Disease Pathway||533
⇄sp_protein_name => string (56) "HLA class II histocompatibility antigen, DP beta 1 chain"
$value[11]['_source']['sp_protein_name']
⇄⧉sp_protein_name_syn => string (85) "HLA class II histocompatibility antigen, DP(W4) beta chain; MHC class II ant...
$value[11]['_source']['sp_protein_name_syn']
HLA class II histocompatibility antigen, DP(W4) beta chain; MHC class II antigen DPB1
⇄⧉specificity => string (183) "This assay has high sensitivity and excellent specificity for detection of h...
$value[12]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of human FOLH1. No significant cross-reactivity or interference between human FOLH1 and analogues was observed.
⇄purity => string (3) "N/A"
$value[12]['_source']['purity']
⇄form => string (3) "N/A"
$value[12]['_source']['form']
⇄concentration => string (3) "N/A"
$value[12]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[12]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[12]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄⧉products_description => string (735) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[12]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for FOLH1 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any FOLH1 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for FOLH1 is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of FOLH1 bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄⧉search_terms => string (878) "aaa18017 human this assay has high sensitivity and excellent specificity for...
$value[12]['_source']['search_terms']
aaa18017 human this assay has high sensitivity and excellent specificity for detection of folh1 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa18017_td elisa kit folate hydrolase prostate specific membrane antigen 1 glutamate carboxypeptidase 2 fgcp folh gcp2 gcpii naalad1 naaladase psm psma mgcp n acetylated alpha linked acidic dipeptidase cell growth inhibiting protein 27 folylpoly gamma carboxypep isoform i carboxylase ii gene variant f pteroylpoly 84,331 da gig27 folh1_human 62548858 np_001014986.1 q04609 nm_001014986.1 o43748 q16305 q541a4 q8tay3 q9np15 a4uu12 a9cb79 b7z312 b7z343 d3dqs5 e9pdx8 600934 samples serum plasma tissue homogenates type quantitative sandwich range 4.7 ng ml 300 < 1.2 intra precision within an cv antigen1 carboxypeptidase2 protein27 range4.7 ml300 <1.2
⇄⧉specificity => string (376) "This assay has high sensitivity and excellent specificity for detection of N...
$value[13]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of NTX1. No significant cross-reactivity or interference between NTX1 and analogues was observed. NOTE: Limited by current skills and knowledge, it is impossible for us to complete the cross-reactivity detection between NTX1 and all the analogues, therefore, cross reaction may still exist in some cases.
⇄purity => string (3) "N/A"
$value[13]['_source']['purity']
⇄form => string (3) "N/A"
$value[13]['_source']['form']
⇄concentration => string (3) "N/A"
$value[13]['_source']['concentration']
⇄storage_stability => string (35) "Store all reagents at 2-8 degree C."
Assay Type||Quantitative Competitive!!Samples||Serum, plasma, cell culture supernatants, body fluid and tissue homogenate!!Sensitivity||1.0 pg/mL
⇄etc_term2 => string (3) "N/A"
$value[13]['_source']['etc_term2']
⇄products_price => string (6) "0.0000"
$value[13]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[13]['_source']['products_weight']
⇄products_status => boolean true
$value[13]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[13]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "720"
$value[13]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[13]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[13]['_source']['language_id']
⇄products_name => string (55) "Cross-linked N-terminal Telopeptides of type I collagen"
$value[13]['_source']['products_name']
⇄products_name_oem => string (72) "Monkey Cross-linked N-terminal Telopeptides of type I collagen ELISA Kit"
$value[13]['_source']['products_name_oem']
⇄products_name_syn => string (3) "N/A"
$value[13]['_source']['products_name_syn']
⇄products_gene_name => string (3) "NTx"
$value[13]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[13]['_source']['products_gene_name_syn']
⇄⧉products_description => string (1390) "Principle of the Assay: NTX1 ELISA kit applies the competitive enzyme immuno...
$value[13]['_source']['products_description']
Principle of the Assay: NTX1 ELISA kit applies the competitive enzyme immunoassay technique utilizing a polyclonal anti-NTX1 antibody and an NTX1-HRP conjugate. The assay sample and buffer are incubated together with NTX1-HRP conjugate in pre-coated plate for one hour. After the incubation period, the wells are decanted and washed five times. The wells are then incubated with a substrate for HRP enzyme. The product of the enzyme-substrate reaction forms a blue colored complex. Finally, a stop solution is added to stop the reaction, which will then turn the solution yellow. The intensity of color is measured spectrophotometrically at 450nm in a microplate reader. The intensity of the color is inversely proportional to the NTX1 concentration since NTX1 from samples and NTX1-HRP conjugate compete for the anti-NTX1 antibody binding site. Since the number of sites is limited, as more sites are occupied by NTX1 from the sample, fewer sites are left to bind NTX1-HRP conjugate. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The NTX1 concentration in each sample is interpolated from this standard curve.<br><br>Intended Uses: This NTX1 ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Monkey NTX1. This ELISA kit for research use only, not for therapeutic or diagnostic applications!
⇄⧉search_terms => string (362) "aaa17050 monkey typical testing data standard curve for reference only aaa17...
$value[13]['_source']['search_terms']
aaa17050 monkey typical testing data standard curve for reference only aaa17050_td elisa kit cross linked n terminal telopeptides of type i collagen ntx partial 146,743 da q9qtg7_cbdp 4579738 baa75084.1 cell biology samples serum plasma culture supernatants body fluid and tissue homogenate assay sandwich detection range 250 5000pg ml sensitivity 1.0pg range250
⇄⧉specificity => string (243) "The mouse monoclonal antibody PcMab-47 recognizes a glycosylation-dependent ...
$value[14]['_source']['specificity']
The mouse monoclonal antibody PcMab-47 recognizes a glycosylation-dependent epitope (aa 207-210) on human PODXL, a highly glycosylated transmembrane glycoprotein expressed above all in many types of cancer tissues, and on embryonic stem cells.
⇄purity => string (46) "Purified by protein-A affinity chromatography."
⇄⧉search_terms => string (826) "aaa20036 mouse human igg1 kappa pcmab 47 purified by protein a affinity chro...
$value[14]['_source']['search_terms']
aaa20036 mouse human igg1 kappa pcmab 47 purified by protein a affinity chromatography phosphate buffered saline pbs ph7.4 15mm sodium azide the monoclonal antibody recognizes glycosylation dependent epitope aa 207 210 on podxl highly glycosylated transmembrane glycoprotein expressed above all in many types of cancer tissues and embryonic stem cells western blot wb flow cytometry fc facs qc tested immunohistochemistry ihc recommended dilution 1 4ug ml separation hela stained anti concentration sample 1,7ug gam apc red filled from unstained primary black dashed analysis surface staining aaa20036_fc hu pclp gp200 podocalyxin like isoform pc gctm 2 antigen 58,635 da pclp1 podxl_human 66277202 np_001018121.1 o00592 nm_001018111.2 q52lz7 q53er6 a6nhx8 602632 immunogen recombinant ectodomain pcmab47 aa207 dilution1 gctm2
⇄⧉etc_term1 => string (175) "Samples||Serum, plasma, Cell Culture Supernatants, body fluid and tissue hom...
$value[15]['_source']['etc_term1']
Samples||Serum, plasma, Cell Culture Supernatants, body fluid and tissue homogenate!!Assay Type||Competitive or Sandwich!!Detection Range||250-5000pg/mL!!Sensitivity||1.0pg/mL
⇄etc_term2 => string (3) "N/A"
$value[15]['_source']['etc_term2']
⇄products_price => string (6) "0.0000"
$value[15]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[15]['_source']['products_weight']
⇄products_status => boolean true
$value[15]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[15]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "720"
$value[15]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[15]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[15]['_source']['language_id']
⇄products_name => string (28) "Bone Morphogenetic Protein 1"
$value[15]['_source']['products_name']
⇄products_name_oem => string (44) "Mouse Bone Morphogenetic Protein 1 ELISA Kit"
$value[15]['_source']['products_name_oem']
⇄products_name_syn => string (3) "N/A"
$value[15]['_source']['products_name_syn']
⇄products_gene_name => string (4) "BMP1"
$value[15]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[15]['_source']['products_gene_name_syn']
⇄⧉products_description => string (1465) "Intended Uses: This BMP-1 ELISA kit is a 1.5 hour solid-phase ELISA designed...
$value[15]['_source']['products_description']
Intended Uses: This BMP-1 ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Mouse BMP-1. This ELISA kit for research use only!<br><br>Principle of the Assay: BMP-1 ELISA kit applies the quantitative sandwich enzyme immunoassay technique. The microtiter plate has been pre-coated with a monoclonal antibody specific for BMP-1. Standards or samples are then added to the microtiter plate wells and BMP-1 if present, will bind to the antibody pre-coated wells. In order to quantitatively determine the amount of BMP-1 present in the sample, a standardized preparation of horseradish peroxidase (HRP)-conjugated polyclonal antibody, specific for BMP-1 are added to each well to "sandwich" the BMP-1 immobilized on the plate. The microtiter plate undergoes incubation, and then the wells are thoroughly washed to remove all unbound components. Next, substrate solutions are added to each well. The enzyme (HRP) and substrate are allowed to react over a short incubation period. Only those wells that contain BMP-1 and enzyme-conjugated antibody will exhibit a change in color. The enzyme-substrate reaction is terminated by addition of a sulphuric acid solution and the color change is measured spectrophotometrically at a wavelength of 450 nm. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The BMP-1 concentration in each sample is interpolated from this standard curve.
⇄products_references => string (3) "N/A"
$value[15]['_source']['products_references']
⇄⧉products_related_diseases => string (216) "Fibrosis||21!!Disease Models, Animal||10!!Nervous System Diseases||7!!Neopla...
Adipogenesis Pathway||198832!!Anchoring Fibril Formation Pathway||730307!!Assembly Of Collagen Fibrils And Other Multimeric Structures Pathway||730306!!Cardiac Progenitor Differentiation Pathway||712094!!Collagen Biosynthesis And Modifying Enzymes Pathway||645289!!Collagen Formation Pathway||645288!!Crosslinking Of Collagen Fibrils Pathway||730308!!Degradation Of The Extracellular Matrix Pathway||576263!!Extracellular Matrix Organization Pathway||576262!!HDL-mediated Lipid Transport Pathway||106158
⇄sp_protein_name => string (28) "Bone morphogenetic protein 1"
⇄⧉specificity => string (176) "This assay has high sensitivity and excellent specificity for detection of C...
$value[16]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of COLEC11 . No significant cross-reactivity or interference between COLEC11 and analogues was observed.
⇄purity => string (3) "N/A"
$value[16]['_source']['purity']
⇄form => string (3) "N/A"
$value[16]['_source']['form']
⇄concentration => string (3) "N/A"
$value[16]['_source']['concentration']
⇄⧉storage_stability => string (156) "Store entire kit at 2-8C for short-term. For longer-term, please store the m...
$value[16]['_source']['storage_stability']
Store entire kit at 2-8C for short-term. For longer-term, please store the microplate & standard at -20C, while the remaining reagents can be stored at 2-8C
Assay Type||Sandwich ELISA, Double Antibody!!Samples||Serum, Plasma, Cell Culture Supernatant, cell or tissue lysate, Other liquid samples!!Detection Range||15.625-1000pg/ml !!Sensitivity||9.375pg/ml
⇄⧉etc_term2 => string (420) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): 3 ...
$value[16]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): 3 samples with low, middle and high level COLEC11 were tested 20 times on one plate, respectively. Intra-Assay: CV<8%!!Inter-assay Precision||Inter-assay Precision (Precision between assays): 3 samples with low, middle and high level COLEC11 were tested on 3 different plates, 8 replicates in each plate. CV (%) = SD/meanX100. Inter-Assay: CV<10%
⇄⧉products_name_syn => string (128) "COLEC11 (Collectin Sub-Family Member 11)/Collectin-11/CL-K1/Dual specificity...
$value[16]['_source']['products_name_syn']
COLEC11 (Collectin Sub-Family Member 11)/Collectin-11/CL-K1/Dual specificity protein kinase CLK1/Protein tyrosine kinase STY/STY
⇄products_gene_name => string (7) "COLEC11"
$value[16]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[16]['_source']['products_gene_name_syn']
⇄⧉products_description => string (846) "Principle of the Assay: This kit was based on sandwich enzyme-linked immune-...
$value[16]['_source']['products_description']
Principle of the Assay: This kit was based on sandwich enzyme-linked immune-sorbent assay technology. Anti- COLEC11 antibody was pre-coated onto 96-well plates. And the biotin conjugated anti- COLEC11 antibody was used as detection antibodies. The standards, test samples and biotin conjugated detection antibody were added to the wells subsequently, and washed with wash buffer. HRPStreptavidin was added and unbound conjugates were washed away with wash buffer. TMB substrates were used to visualize HRP enzymatic reaction. TMB was catalyzed by HRP to produce a blue color product that changed into yellow after adding acidic stop solution. The density of yellow is proportional to the COLEC11 amount of sample captured in plate. Read the O.D. absorbance at 450nm in a microplate reader, and then the concentration of COLEC11 can be calculated.
⇄⧉ncbi_pathways => string (218) "Binding And Uptake Of Ligands By Scavenger Receptors Pathway||1269897!!Phago...
$value[16]['_source']['ncbi_pathways']
Binding And Uptake Of Ligands By Scavenger Receptors Pathway||1269897!!Phagosome Pathway||153910!!Phagosome Pathway||153859!!Scavenging By Class A Receptors Pathway||1269899!!Vesicle-mediated Transport Pathway||1269876
⇄sp_protein_name => string (12) "Collectin-11"
$value[16]['_source']['sp_protein_name']
⇄sp_protein_name_syn => string (33) "Collectin kidney protein 1; CL-K1"
⇄⧉search_terms => string (638) "aaa17475 human this assay has high sensitivity and excellent specificity for...
$value[16]['_source']['search_terms']
aaa17475 human this assay has high sensitivity and excellent specificity for detection of colec11 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa17475_td elisa kit collectin 11 sub family member cl k1 dual protein kinase clk1 tyrosine sty isoform a subfamily 3mc2 i ii iia iib 30,200 da kidney 1 col11_human 13128972 np_076932.1 q9bwp8 nm_024027.4 q5cz85 a1ige4 a1ige5 a1ige6 a7vjj2 a7vjj3 a7vjj4 a7vjj5 b2r9m5 b4e1g0 j3kqy9 265050 samples serum plasma tissue homogenates other biological fluids type sandwich range 15.625 1000pg ml collectin11 kidney1
⇄specificity => string (24) "Recognizes human AGTRAP."
$value[17]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[17]['_source']['purity']
⇄⧉form => string (102) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with hor...
$value[17]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
⇄concentration => string (3) "N/A"
$value[17]['_source']['concentration']
⇄⧉storage_stability => string (537) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value[17]['_source']['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄app_tested => string (67) "ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)"
$value[17]['_source']['app_tested']
⇄app_notes => string (67) "IHC-P: 0.8ug/ml<br>Applications are based on unconjugated antibody."
$value[17]['_source']['app_notes']
⇄⧉testing_protocols => string (1031) "WB (Western Blot)||AGTRAP monoclonal antibody, Western Blot analysis of AGTR...
$value[17]['_source']['testing_protocols']
WB (Western Blot)||AGTRAP monoclonal antibody, Western Blot analysis of AGTRAP expression in Hela NE.||AAA25311_WB6.jpg!!Application Data||Detection limit for recombinant GST tagged AGTRAP is ~0.1ng/ml as a capture antibody.||AAA25311_APP5.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to AGTRAP on formalin-fixed paraffin-embedded human prostate. [antibody concentration 0.8ug/ml].||AAA25311_IHC4.jpg!!WB (Western Blot)||Western Blot analysis of AGTRAP expression in transfected 293T cell line by AGTRAP monoclonal antibody. Lane 1: AGTRAP transfected lysate (16.7kD). Lane 2: Non-transfected lysate.||AAA25311_WB3.jpg!!WB (Western Blot)||Western blot analysis of AGTRAP over-expressed 293 cell line, cotransfected with AGTRAP Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with AGTRAP monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.||AAA25311_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (31.83kD).||AAA25311_WB.jpg
⇄⧉etc_term1 => string (224) "Immunogen||Partial recombinant corresponding to aa108-210 from human AGTRAP ...
$value[17]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa108-210 from human AGTRAP (NP_065083) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||HMYRERGGELLVHTGFLGSSQDRSAYQTIDSAEAPADPFAVPEGRSQDARGS!!Conjugate||HRP
⇄⧉search_terms => string (1083) "aaa25311 mouse human monoclonal igg1,k 1g2 purified by protein a affinity ch...
$value[17]['_source']['search_terms']
aaa25311 mouse human monoclonal igg1,k 1g2 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with horseradish peroxidase hrp recognizes agtrap elisa eia immunohistochemistry ihc paraffin western blot wb p 0.8ug ml applications are based on unconjugated antibody detection against immunogen 31.83kd aaa25311_wb analysis of over expressed 293 cell line cotransfected validated chimera rnai lane 2 or non transfected control 1 probed gapdh 36.1kd used specificity and loading aaa25311_wb2 expression 293t lysate 16.7kd aaa25311_wb3 immunoperoxidase to formalin fixed embedded prostate concentration aaa25311_ihc4 testing data limit for recombinant gst tagged is ~0.1ng capture aaa25311_td5 hela ne aaa25311_wb6 atrap type angiotensin ii receptor associated at1 mgc29646 isoform atrap_human 93588500 np_065083 q6rw13 nm_020350 608729 gene antibodies ogen partial corresponding aa108 210 from tag mw the alone 26kd sequence hmyrerggellvhtgflgssqdrsayqtidsaeapadpfavpegrsqdargs conjugate ph7.2 expressed293 lane2 control1 aa108210
⇄⧉specificity => string (181) "This assay has high sensitivity and excellent specificity for detection of h...
$value[18]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of human YBX1. No significant cross-reactivity or interference between human YBX1 and analogues was observed.
⇄purity => string (3) "N/A"
$value[18]['_source']['purity']
⇄form => string (3) "N/A"
$value[18]['_source']['form']
⇄concentration => string (3) "N/A"
$value[18]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[18]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (326) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[18]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%.Three samples of known concentration were tested in twenty assays to assess.
⇄products_price => string (6) "0.0000"
$value[18]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[18]['_source']['products_weight']
⇄products_status => boolean true
$value[18]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[18]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "700"
$value[18]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[18]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[18]['_source']['language_id']
⇄products_name => string (23) "Y box binding protein 1"
Human Nuclease-sensitive element-binding protein 1 (YBX1) ELISA kit; BP-8; CSDA2; CSDB; DBPB; MDR-NF1; MGC104858; MGC110976; MGC117250; NSEP-1; NSEP1; YB-1; YB1; DNA-binding protein B; major histocompatibility complex; class II; Y box-binding protein I; nuclease sensit; Y box binding protein 1
⇄products_gene_name => string (4) "YBX1"
$value[18]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[18]['_source']['products_gene_name_syn']
⇄⧉products_description => string (731) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[18]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for YBX1 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any YBX1 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for YBX1 is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of YBX1 bound in the initial step. The color development is stopped and the intensity of the color is measured.
nuclease-sensitive element-binding protein 1; CBF-A; EFI-A; DNA-binding protein B; Y-box-binding protein 1; Y-box transcription factor; enhancer factor I subunit A; nuclease sensitive element binding protein 1; CCAAT-binding transcription factor I subunit A; major histocompatibility complex, class II, Y box-binding protein I
⇄⧉search_terms => string (741) "aaa18328 human this assay has high sensitivity and excellent specificity for...
$value[18]['_source']['search_terms']
aaa18328 human this assay has high sensitivity and excellent specificity for detection of ybx1 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa18328_td elisa kit y box binding protein 1 nuclease sensitive element bp 8 csda2 csdb dbpb mdr nf1 mgc104858 mgc110976 mgc117250 nsep nsep1 yb yb1 dna b major histocompatibility complex class ii i sensit cbf a efi transcription factor enhancer subunit ccaat 35,924 da ybox1_human 34098946 np_004550.2 p67809 nm_004559.3 p16990 p16991 q14972 q15325 q5fvf0 154030 samples serum plasma tissue homogenates cell lysates type quantitative sandwich range 31.25 pg ml 2000 < 7.81 intra precision within an cv protein1 bp8
⇄⧉specificity => string (185) "This assay has high sensitivity and excellent specificity for detection of h...
$value[19]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of human ANX-II. No significant cross-reactivity or interference between human ANX-II and analogues was observed.
⇄purity => string (3) "N/A"
$value[19]['_source']['purity']
⇄form => string (3) "N/A"
$value[19]['_source']['form']
⇄concentration => string (3) "N/A"
$value[19]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[19]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[19]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄products_price => string (6) "0.0000"
$value[19]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[19]['_source']['products_weight']
⇄products_status => boolean true
$value[19]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[19]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "700"
$value[19]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[19]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[19]['_source']['language_id']
⇄products_name => string (10) "annexin A2"
$value[19]['_source']['products_name']
⇄products_name_oem => string (34) "Human Annexin II, ANX-II ELISA Kit"
Human Annexin II (ANX-II) ELISA Kit; ANX2; ANX2L4; CAL1H; LIP2; LPC2; LPC2D; P36; PAP-IV; annexin II; calpactin I heavy polypeptide; chromobindin 8; lipocortin II; placental anticoagulant protein IV; annexin A2
⇄products_gene_name => string (5) "ANXA2"
$value[19]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[19]['_source']['products_gene_name_syn']
⇄⧉products_description => string (739) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[19]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for ANX-II has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any ANX-II present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for ANX-II is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of ANX-II bound in the initial step. The color development is stopped and the intensity of the color is measured.
annexin A2; annexin-2; protein I; annexin II; lipocortin II; chromobindin 8; chromobindin-8; calpactin I heavy chain; calpactin-1 heavy chain; calpactin I heavy polypeptide; placental anticoagulant protein IV; epididymis secretory protein Li 270
⇄ncbi_chrom_loc => string (3) "N/A"
$value[19]['_source']['ncbi_chrom_loc']
⇄ncbi_gene_id => string (3) "302"
$value[19]['_source']['ncbi_gene_id']
⇄ncbi_mol_weight => string (9) "38,604 Da"
$value[19]['_source']['ncbi_mol_weight']
⇄⧉ncbi_pathways => string (126) "Dissolution Of Fibrin Clot Pathway||106061!!Hemostasis Pathway||106028!!Pros...
$value[19]['_source']['ncbi_pathways']
Dissolution Of Fibrin Clot Pathway||106061!!Hemostasis Pathway||106028!!Prostaglandin Synthesis And Regulation Pathway||198912
⇄sp_protein_name => string (10) "Annexin A2"
$value[19]['_source']['sp_protein_name']
⇄⧉sp_protein_name_syn => string (162) "Annexin II; Annexin-2; Calpactin I heavy chain; Calpactin-1 heavy chain; Chr...
$value[19]['_source']['sp_protein_name_syn']
Annexin II; Annexin-2; Calpactin I heavy chain; Calpactin-1 heavy chain; Chromobindin-8; Lipocortin II; Placental anticoagulant protein IV; PAP-IV; Protein I; p36
⇄⧉search_terms => string (687) "aaa15127 human this assay has high sensitivity and excellent specificity for...
$value[19]['_source']['search_terms']
aaa15127 human this assay has high sensitivity and excellent specificity for detection of anx ii no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa15127_td elisa kit annexin a2 anx2 anx2l4 cal1h lip2 lpc2 lpc2d p36 pap iv calpactin i heavy polypeptide chromobindin 8 lipocortin placental anticoagulant protein anxa2 isoform 2 hel s 270 chain 1 epididymis secretory li 38,604 da anxa2_human 50845386 np_001002857.1 p07355 nm_001002857.1 q567r4 q6n0b3 q8tbv2 q96dd5 q9udh8 151740 samples serum urine saliva cell lysates type quantitative sandwich range 0.39 ng ml 25 chromobindin8 isoform2 s270 chain1 ml25
