TEPSIN blocking peptide
TEPSIN Peptide - N-terminal region
Gene Names
Tepsin; Enthd2; RGD1307410
Reactivity
Rat, Human
Applications
Western Blot
Synonyms
TEPSIN; TEPSIN Peptide - N-terminal region; TEPSIN blocking peptide
Reactivity
Rat, Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: LSFLHRLPILLKGTSDDDIPCPGYLFEEIAKISHESLGSSQCLLEYLLNR
Sequence Length
569
Applicable Applications for TEPSIN blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Product Categories/Family for TEPSIN blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62kDa
NCBI Official Synonym Full Names
TEPSIN, adaptor related protein complex 4 accessory protein
NCBI Official Symbol
Tepsin
NCBI Official Synonym Symbols
Enthd2; RGD1307410
NCBI Protein Information
AP-4 complex accessory subunit tepsin
UniProt Protein Name
AP-4 complex accessory subunit tepsin
UniProt Gene Name
Enthd2
UniProt Entry Name
AP4AT_RAT
Uniprot Description
ENTHD2: 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral
Cellular Component: cytoplasmic membrane-bound vesicle; cytosol
Similar Products
Product Notes
The TEPSIN enthd2 (Catalog #AAA3242631) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The TEPSIN Peptide - N-terminal region reacts with Rat, Human and may cross-react with other species as described in the data sheet. AAA Biotech's TEPSIN can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TEPSIN enthd2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LSFLHRLPIL LKGTSDDDIP CPGYLFEEIA KISHESLGSS QCLLEYLLNR. It is sometimes possible for the material contained within the vial of "TEPSIN, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
