Map1lc3a blocking peptide
Map1lc3a Peptide - N-terminal region
Gene Names
Map1lc3a; LC3A; LC3-I; LC3-II
Reactivity
Rat, Human
Applications
Western Blot
Synonyms
Map1lc3a; Map1lc3a Peptide - N-terminal region; Map1lc3a blocking peptide
Reactivity
Rat, Human
Form/Format
Lyophilized powder
Sequence
CKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKI
Sequence Length
121
Applicable Applications for Map1lc3a blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for Map1lc3a blocking peptide
This is a synthetic peptide designed for use in combination with anti-Map1lc3a Antibody, made
Target Description: Map1lc3a is a light chain subunit of MAP1A and MAP1B microtubule-associated proteins; It mediates interactions between microtubules and the cytoskeleton.
Target Description: Map1lc3a is a light chain subunit of MAP1A and MAP1B microtubule-associated proteins; It mediates interactions between microtubules and the cytoskeleton.
Product Categories/Family for Map1lc3a blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13kDa
NCBI Official Full Name
microtubule-associated proteins 1A/1B light chain 3A
NCBI Official Synonym Full Names
microtubule-associated protein 1 light chain 3 alpha
NCBI Official Symbol
Map1lc3a
NCBI Official Synonym Symbols
LC3A; LC3-I; LC3-II
NCBI Protein Information
microtubule-associated proteins 1A/1B light chain 3A
UniProt Protein Name
Microtubule-associated proteins 1A/1B light chain 3A
Protein Family
UniProt Gene Name
Map1lc3a
UniProt Synonym Gene Names
MAP1A/MAP1B LC3 A
UniProt Entry Name
MLP3A_RAT
NCBI Description
light chain subunit of MAP1A and MAP1B microtubule-associated proteins; mediates interactions between microtubules and the cytoskeleton [RGD, Feb 2006]
Research Articles on Map1lc3a
Similar Products
Product Notes
The Map1lc3a map1lc3a (Catalog #AAA3239046) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Map1lc3a Peptide - N-terminal region reacts with Rat, Human and may cross-react with other species as described in the data sheet. AAA Biotech's Map1lc3a can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the Map1lc3a map1lc3a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: CKEVQQIRDQ HPSKIPVIIE RYKGEKQLPV LDKTKFLVPD HVNMSELVKI. It is sometimes possible for the material contained within the vial of "Map1lc3a, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
