Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Cryab blocking peptide

Cryab Peptide - N-terminal region

Gene Names
Cryab; AACRYA
Reactivity
Rat, Human
Applications
Western Blot
Synonyms
Cryab; Cryab Peptide - N-terminal region; Cryab blocking peptide
Ordering
For Research Use Only!
Reactivity
Rat, Human
Form/Format
Lyophilized powder
Sequence
RPFFPFHSPSRLFDQFFGEHLLESDLFSTATSLSPFYLRPPSFLRAPSWI
Sequence Length
175
Applicable Applications for Cryab blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for Cryab blocking peptide
This is a synthetic peptide designed for use in combination with anti-Cryab Antibody, made

Target Description: Cryab is a structural constituent of the lens that may have non-ocular functions as well; it may play a role in response to cardiac stress during ischemia.
Product Categories/Family for Cryab blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19kDa
NCBI Official Full Name
alpha-crystallin B chain
NCBI Official Synonym Full Names
crystallin, alpha B
NCBI Official Symbol
Cryab
NCBI Official Synonym Symbols
AACRYA
NCBI Protein Information
alpha-crystallin B chain
UniProt Protein Name
Alpha-crystallin B chain
Protein Family
UniProt Gene Name
Cryab

NCBI Description

This gene encodes subunit b, one of two subunits of alpha-crystallin, which is a high molecular weight, soluble aggregate and is a member of the small heat shock protein family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. It acts as a molecular chaperone and is the major protein in the eye lens, maintaining the transparency and refractive index of the lens. Alternate promoter usage results in different transcript variants encoding the same protein. [provided by RefSeq, Sep 2014]

Uniprot Description

May contribute to the transparency and refractive index of the lens. Has chaperone-like activity, preventing aggregation of various proteins under a wide range of stress conditions.

Research Articles on Cryab

Similar Products

Product Notes

The Cryab cryab (Catalog #AAA3233877) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Cryab Peptide - N-terminal region reacts with Rat, Human and may cross-react with other species as described in the data sheet. AAA Biotech's Cryab can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the Cryab cryab for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RPFFPFHSPS RLFDQFFGEH LLESDLFSTA TSLSPFYLRP PSFLRAPSWI. It is sometimes possible for the material contained within the vial of "Cryab, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.