Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Ywhag blocking peptide

Ywhag Peptide - N-terminal region

Gene Names
Ywhag; D7Bwg1348e; 14-3-3gamma
Reactivity
Mouse, Human
Applications
Western Blot
Synonyms
Ywhag; Ywhag Peptide - N-terminal region; Ywhag blocking peptide
Ordering
For Research Use Only!
Reactivity
Mouse, Human
Form/Format
Lyophilized powder
Sequence
EERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKI
Sequence Length
247
Applicable Applications for Ywhag blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for Ywhag blocking peptide
This is a synthetic peptide designed for use in combination with anti-Ywhag Antibody, made

Target Description: Ywhag is an adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Ywhag binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Ywhag binding generally results in the modulation of the activity of the binding partner.
Product Categories/Family for Ywhag blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
14-3-3 protein gamma
NCBI Official Synonym Full Names
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide
NCBI Official Symbol
Ywhag
NCBI Official Synonym Symbols
D7Bwg1348e; 14-3-3gamma
NCBI Protein Information
14-3-3 protein gamma
UniProt Protein Name
14-3-3 protein gamma
Protein Family
UniProt Gene Name
Ywhag
UniProt Entry Name
1433G_MOUSE

Uniprot Description

14-3-3 gamma: Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Homodimer. Interacts with SAMSN1. Interacts with RAF1, SSH1 and CRTC2/TORC2. Interacts with ABL1 (phosphorylated form); the interaction retains it in the cytoplasm. Interacts with GAB2. Interacts with MDM4 (phosphorylated); negatively regulates MDM4 activity toward TP53. Interacts with PKA-phosphorylated AANAT. Highly expressed in brain, skeletal muscle, and heart. Belongs to the 14-3-3 family.

Protein type: Adaptor/scaffold

Cellular Component: focal adhesion; membrane; cytoplasm; intracellular; myelin sheath

Molecular Function: protein domain specific binding; insulin-like growth factor receptor binding; protein binding; protein kinase C binding; receptor tyrosine kinase binding

Biological Process: cellular response to insulin stimulus; regulation of neuron differentiation; regulation of synaptic plasticity; protein targeting

Research Articles on Ywhag

Similar Products

Product Notes

The Ywhag ywhag (Catalog #AAA3225087) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Ywhag Peptide - N-terminal region reacts with Mouse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's Ywhag can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the Ywhag ywhag for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EERNLLSVAY KNVVGARRSS WRVISSIEQK TSADGNEKKI EMVRAYREKI. It is sometimes possible for the material contained within the vial of "Ywhag, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.