Rngtt blocking peptide
Rngtt Peptide - C-terminal region
Gene Names
Rngtt; HCE; MCE1; AU020997
Reactivity
Mouse, Human
Applications
Western Blot
Synonyms
Rngtt; Rngtt Peptide - C-terminal region; Rngtt blocking peptide
Reactivity
Mouse, Human
Form/Format
Lyophilized powder
Sequence
DLTNTSRFYDRNDIEKEGIKYIKLQCKGHGECPTTENTETFIRLCERFNE
Sequence Length
597
Applicable Applications for Rngtt blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for Rngtt blocking peptide
This is a synthetic peptide designed for use in combination with anti-Rngtt Antibody, made
Target Description: Rngtt is a bifunctional mRNA-capping enzyme exhibiting RNA 5'-triphosphatase activity in the N-terminal part and mRNA guanylyltransferase activity in the C-terminal part. It catalyzes the first two steps of cap formation: by removing the gamma-phosphate from the 5'-triphosphate end of nascent mRNA to yield a diphosphate end, and by transferring the gmp moiety of GTP to the 5'-diphosphate terminus.
Target Description: Rngtt is a bifunctional mRNA-capping enzyme exhibiting RNA 5'-triphosphatase activity in the N-terminal part and mRNA guanylyltransferase activity in the C-terminal part. It catalyzes the first two steps of cap formation: by removing the gamma-phosphate from the 5'-triphosphate end of nascent mRNA to yield a diphosphate end, and by transferring the gmp moiety of GTP to the 5'-diphosphate terminus.
Product Categories/Family for Rngtt blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
69kDa
NCBI Official Full Name
mRNA-capping enzyme isoform 1
NCBI Official Synonym Full Names
RNA guanylyltransferase and 5'-phosphatase
NCBI Official Symbol
Rngtt
NCBI Official Synonym Symbols
HCE; MCE1; AU020997
NCBI Protein Information
mRNA-capping enzyme
UniProt Protein Name
mRNA-capping enzyme
UniProt Gene Name
Rngtt
UniProt Synonym Gene Names
Cap1a; TPase; mRNA 5'-triphosphatase; GTase
Uniprot Description
Bifunctional mRNA-capping enzyme exhibiting RNA 5'-triphosphatase activity in the N-terminal part and mRNA guanylyltransferase activity in the C-terminal part. Catalyzes the first two steps of cap formation: by removing the gamma-phosphate from the 5'-triphosphate end of nascent mRNA to yield a diphosphate end, and by transferring the gmp moiety of GTP to the 5'-diphosphate terminus.
Research Articles on Rngtt
Similar Products
Product Notes
The Rngtt rngtt (Catalog #AAA3234053) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Rngtt Peptide - C-terminal region reacts with Mouse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's Rngtt can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the Rngtt rngtt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DLTNTSRFYD RNDIEKEGIK YIKLQCKGHG ECPTTENTET FIRLCERFNE. It is sometimes possible for the material contained within the vial of "Rngtt, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
