Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mlxipl blocking peptide

Mlxipl Peptide - N-terminal region

Gene Names
Mlxipl; Mlx; ChREBP; WS-bHLH; Wbscr14; bHLHd14
Reactivity
MOUSE, Human
Applications
Western Blot
Synonyms
Mlxipl; Mlxipl Peptide - N-terminal region; Mlxipl blocking peptide
Ordering
For Research Use Only!
Reactivity
MOUSE, Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: VCGFVTPLQGSEADEHRKPEAVILEGNYWKRRIEVVMREYHKWRIYYKKR
Sequence Length
714
Applicable Applications for Mlxipl blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for Mlxipl blocking peptide
This is a synthetic peptide designed for use in combination with anti-Mlxipl Antibody, made

Target Description: Mlxipl is a transcriptional repressor. It binds to the canonical and non-canonical E box sequences 5'-CACGTG-3'.
Product Categories/Family for Mlxipl blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
78kDa
NCBI Official Full Name
carbohydrate-responsive element-binding protein isoform 1
NCBI Official Synonym Full Names
MLX interacting protein-like
NCBI Official Symbol
Mlxipl
NCBI Official Synonym Symbols
Mlx; ChREBP; WS-bHLH; Wbscr14; bHLHd14
NCBI Protein Information
carbohydrate-responsive element-binding protein
UniProt Protein Name
Carbohydrate-responsive element-binding protein
UniProt Gene Name
Mlxipl
UniProt Synonym Gene Names
Mio; Wbscr14; ChREBP

Uniprot Description

ChREBP: Transcriptional repressor. Binds to the canonical and non-canonical E box sequences 5'-CACGTG-3'. Binds DNA as a heterodimer with TCFL4/MLX. Expressed in liver, heart, kidney, cerebellum and intestinal tissues. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor

Chromosomal Location of Human Ortholog: 5|5 G2

Cellular Component: cytoplasm; cytosol; nucleus; transcription factor complex

Molecular Function: DNA binding; DNA binding transcription factor activity; protein binding; protein dimerization activity; protein heterodimerization activity; protein kinase binding; sequence-specific DNA binding; transcription factor binding

Biological Process: cellular response to glucose stimulus; fatty acid homeostasis; glucose homeostasis; glucose mediated signaling; negative regulation of cell cycle arrest; negative regulation of oxidative phosphorylation; negative regulation of peptidyl-serine phosphorylation; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; positive regulation of cell proliferation; positive regulation of fatty acid biosynthetic process; positive regulation of glycolysis; positive regulation of lipid biosynthetic process; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-templated; regulation of energy homeostasis; regulation of glycolysis; regulation of transcription from RNA polymerase II promoter; regulation of transcription, DNA-templated; response to glucose stimulus; transcription, DNA-dependent

Research Articles on Mlxipl

Similar Products

Product Notes

The Mlxipl mlxipl (Catalog #AAA3228500) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Mlxipl Peptide - N-terminal region reacts with MOUSE, Human and may cross-react with other species as described in the data sheet. AAA Biotech's Mlxipl can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the Mlxipl mlxipl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VCGFVTPLQG SEADEHRKPE AVILEGNYWK RRIEVVMREY HKWRIYYKKR. It is sometimes possible for the material contained within the vial of "Mlxipl, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.