Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Epha4 blocking peptide

Epha4 Peptide - C-terminal region

Gene Names
Epha4; rb; Sek; Cek8; Hek8; Sek1; Tyro1; AI385584; 2900005C20Rik
Reactivity
Mouse, Human
Applications
Immunohistochemistry, Western Blot
Synonyms
Epha4; Epha4 Peptide - C-terminal region; Epha4 blocking peptide
Ordering
For Research Use Only!
Reactivity
Mouse, Human
Form/Format
Lyophilized powder
Sequence
VISRRRSKYSKAKQEADEEKHLNQGVRTYVDPFTYEDPNQAVREFAKEID
Sequence Length
986
Applicable Applications for Epha4 blocking peptide
Immunohistochemistry (IHC), Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for Epha4 blocking peptide
This is a synthetic peptide designed for use in combination with anti-Epha4 Antibody, made

Target Description: Epha4 is a receptor tyrosine kinase which binds membrane-bound ephrin family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells.
Product Categories/Family for Epha4 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
110kDa
NCBI Official Full Name
ephrin type-A receptor 4
NCBI Official Synonym Full Names
Eph receptor A4
NCBI Official Symbol
Epha4
NCBI Official Synonym Symbols
rb; Sek; Cek8; Hek8; Sek1; Tyro1; AI385584; 2900005C20Rik
NCBI Protein Information
ephrin type-A receptor 4
UniProt Protein Name
Ephrin type-A receptor 4
Protein Family
UniProt Gene Name
Epha4
UniProt Synonym Gene Names
Sek; Sek1

Uniprot Description

EphA4: a tyrosine kinase receptor of the Eph family. Receptor for members of the ephrin-A family. Binds to ephrin-A1, -A4 and -A5. Binds more poorly to ephrin-A2 and -A3. May play a role in hindbrain pattern formation. The Eph receptor tyrosine kinase family, the largest in the tyrosine kinase group, has fourteen members. They bind membrane-anchored ligands, ephrins, at sites of cell-cell contact, regulating the repulsion and adhesion of cells that underlie the establishment, maintenance, and remodeling of patterns of cellular organization. Eph signals are particularly important in regulating cell adhesion and cell migration during development, axon guidance, homeostasis and disease. EphA receptors bind to GPI-anchored ephrin-A ligands, while EphB receptors bind to ephrin-B proteins that have a transmembrane and cytoplasmic domain. Interactions between EphB receptor kinases and ephrin-B proteins transduce signals bidirectionally, signaling to both interacting cell types. Eph receptors and ephrins also regulate the adhesion of endothelial cells and are required for the remodeling of blood vessels.

Protein type: EC 2.7.10.1; Eph family; Kinase, protein; Membrane protein, integral; Protein kinase, TK; Protein kinase, tyrosine (receptor); TK group

Chromosomal Location of Human Ortholog: 1 C4|1 39.55 cM

Cellular Component: axon; cell projection; cell surface; cytoplasm; dendrite; dendritic spine; early endosome membrane; endoplasmic reticulum; filopodium; Golgi apparatus; integral to plasma membrane; mitochondrial outer membrane; nerve terminal; neuromuscular junction; perikaryon; plasma membrane; postsynaptic density

Molecular Function: ephrin receptor binding; GPI-linked ephrin receptor activity; PH domain binding; protein binding; protein kinase activity; transmembrane-ephrin receptor activity

Biological Process: adult walking behavior; axon guidance; corticospinal tract morphogenesis; glial cell migration; motor axon guidance; negative regulation of axon regeneration; peptidyl-tyrosine phosphorylation; positive regulation of dendrite morphogenesis; positive regulation of JNK activity; protein amino acid autophosphorylation; regulation of astrocyte differentiation; regulation of axonogenesis; regulation of GTPase activity

Research Articles on Epha4

Similar Products

Product Notes

The Epha4 epha4 (Catalog #AAA3240202) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Epha4 Peptide - C-terminal region reacts with Mouse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's Epha4 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the Epha4 epha4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VISRRRSKYS KAKQEADEEK HLNQGVRTYV DPFTYEDPNQ AVREFAKEID. It is sometimes possible for the material contained within the vial of "Epha4, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.