IP (Immunoprecipitation)
(Immunoprecipitation of MRPL11 in 500 ug extracts from HeLa cells using 3 ug MRPL11 Rabbit pAb (AAA283236). Western blot analysis was performed using MRPL11 Rabbit pAb (AAA283236) at 1:1000 dilution.)
Rabbit anti-Human MRPL11 Polyclonal Antibody | anti-MRPL11 antibody
[KD Validated] MRPL11 Rabbit pAb
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Affinity purification
Synonyms
MRPL11, Antibody; [KD Validated] MRPL11 Rabbit pAb; MRPL11; CGI-113; L11MT; MRP-L11; mitochondrial ribosomal protein L11; anti-MRPL11 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
LKAAAGIEKGARQTGKEVAGLVTLKHVYEIARIKAQDEAFALQDVPLSSVVRSIIGSARSLGIRVVKDLSSEELAAFQKERAIFLAAQKEADLAAQEEAAKK
Applicable Applications for anti-MRPL11 antibody
ELISA, IP (Immunoprecipitation), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 91-192 of human MRPL11(NP_057134.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
IP (Immunoprecipitation)
(Immunoprecipitation of MRPL11 in 500 ug extracts from HeLa cells using 3 ug MRPL11 Rabbit pAb (AAA283236). Western blot analysis was performed using MRPL11 Rabbit pAb (AAA283236) at 1:1000 dilution.)
IP (Immunoprecipitation)
(Immunoprecipitation of MRPL11 in 500 ug extracts from HeLa cells using 3 ug MRPL11 Rabbit pAb (AAA283236). Western blot analysis was performed using MRPL11 Rabbit pAb (AAA283236) at 1:1000 dilution.)
WB (Western Blot)
(Western blot analysis of lysates from wild type (WT) and MRPL11 knockdown (KD) HeLa cells using [KD Validated] MRPL11 Rabbit pAb (AAA283236) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
WB (Western Blot)
(Western blot analysis of lysates from wild type (WT) and MRPL11 knockdown (KD) HeLa cells using [KD Validated] MRPL11 Rabbit pAb (AAA283236) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Related Product Information for anti-MRPL11 antibody
This nuclear gene encodes a 39S subunit component of the mitochondial ribosome. Alternative splicing results in multiple transcript variants. Pseudogenes for this gene are found on chromosomes 5 and 12.
Product Categories/Family for anti-MRPL11 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated MW: 18kDa/19kDa/20kDa
Observed MW: 21kDa
Observed MW: 21kDa
UniProt Protein Name
39S ribosomal protein L11, mitochondrial
UniProt Gene Name
MRPL11
UniProt Synonym Gene Names
L11mt; MRP-L11
UniProt Entry Name
RM11_HUMAN
Similar Products
Product Notes
The MRPL11 mrpl11 (Catalog #AAA283236) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The [KD Validated] MRPL11 Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MRPL11 can be used in a range of immunoassay formats including, but not limited to, ELISA, IP (Immunoprecipitation), WB (Western Blot). Researchers should empirically determine the suitability of the MRPL11 mrpl11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LKAAAGIEKG ARQTGKEVAG LVTLKHVYEI ARIKAQDEAF ALQDVPLSSV VRSIIGSARS LGIRVVKDLS SEELAAFQKE RAIFLAAQKE ADLAAQEEAA KK. It is sometimes possible for the material contained within the vial of "MRPL11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.