Highly validated and characterized monoclonal/polyclonal
antibodies and recombinant
proteins
The majority of AAA Biotech’s antibodies are highly validated and can be use in multiple
applications such as ELISA, FC,
ICC, IF, IHC, IP, WB, etc. We have antibodies available for rare species, in multiple conjugated
forms or recombinant
antibodies.
As for our high quality proteins, the majority have 90% purity, detected by SDS-PAGE while some are
available in
different tags such as Flag, GST, His, MBP, etc. We also carry high quality native and biologically
active proteins.
AAA Biotech is constantly working to expand our capacity to provide recombinant proteins and
antibodies to most
target proteins.
SELECT `p`.*, `pd`.*, IFNULL(pdns.ncbi_summary, "N/A") as ncbi_summary_pdns, IFNULL(pdns.sp_comments, "N/A") as sp_comments_pdns, IFNULL(pdns.ncbi_research_articles, "N/A") as ncbi_research_articles_pdns, IFNULL(pe.products_description_extra, "N/A") as products_description_extra
FROM (`products`, `products` as `p`)
LEFT OUTER JOIN `products_description` as `pd` ON `p`.`products_id` = `pd`.`products_id`
LEFT OUTER JOIN `products_description_ncbi_sp` as `pdns` ON `p`.`products_id` = `pdns`.`products_id`
LEFT OUTER JOIN `products_extra` as `pe` ON `p`.`products_id` = `pe`.`products_id`
WHERE `p`.`products_id` = '28314'
AND `pd`.`language_id` = 1
LIMIT 1
Query
Database
1.84 ms
select p.*, pd.*,
ifnull(pdns.ncbi_summary, 'N/A') as ncbi_summary_pdns,
ifnull(pdns.sp_comments, 'N/A') as sp_comments_pdns,
ifnull(pdns.ncbi_research_articles, 'N/A') as ncbi_research_articles_pdns,
ifnull(pe.products_description_extra, 'N/A') as products_description_extra
from products p
LEFT OUTER JOIN products_description pd on p.products_id = pd.products_id
LEFT OUTER JOIN products_description_ncbi_sp pdns on p.products_id = pdns.products_id
LEFT OUTER JOIN products_extra pe on p.products_id = pe.products_id
where p.products_id = '28314' and pd.language_id = 1
Query
Database
1.36 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '28314'
Database (4 total Queries, 4 of them unique across 2 Connections)
Time
Query String
2.11 ms
SELECT `p`.*, `pd`.*, IFNULL(pdns.ncbi_summary, "N/A") as ncbi_summary_pdns, IFNULL(pdns.sp_comments, "N/A") as sp_comments_pdns, IFNULL(pdns.ncbi_research_articles, "N/A") as ncbi_research_articles_pdns, IFNULL(pe.products_description_extra, "N/A") as products_description_extra
FROM (`products`, `products` as `p`)
LEFT OUTER JOIN `products_description` as `pd` ON `p`.`products_id` = `pd`.`products_id`
LEFT OUTER JOIN `products_description_ncbi_sp` as `pdns` ON `p`.`products_id` = `pdns`.`products_id`
LEFT OUTER JOIN `products_extra` as `pe` ON `p`.`products_id` = `pe`.`products_id`
WHERE `p`.`products_id` = '28314'
AND `pd`.`language_id` = 1
LIMIT 1
select p.*, pd.*,
ifnull(pdns.ncbi_summary, 'N/A') as ncbi_summary_pdns,
ifnull(pdns.sp_comments, 'N/A') as sp_comments_pdns,
ifnull(pdns.ncbi_research_articles, 'N/A') as ncbi_research_articles_pdns,
ifnull(pe.products_description_extra, 'N/A') as products_description_extra
from products p
LEFT OUTER JOIN products_description pd on p.products_id = pd.products_id
LEFT OUTER JOIN products_description_ncbi_sp pdns on p.products_id = pdns.products_id
LEFT OUTER JOIN products_extra pe on p.products_id = pe.products_id
where p.products_id = '28314' and pd.language_id = 1
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '28314'
⇄⧉testing_protocols => string (1732) "IF (Immunofluorescence)||Immunofluorescence analysis of mouse colon using Ga...
$value['testing_protocols']
IF (Immunofluorescence)||Immunofluorescence analysis of mouse colon using Galectin 3/Galectin 3/LGALS3 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.||AAA28314_IF8.jpg!!IF (Immunofluorescence)||Immunofluorescence analysis of human colon carcinoma using Galectin 3/Galectin 3/LGALS3 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.||AAA28314_IF7.jpg!!IF (Immunofluorescence)||Immunofluorescence analysis of rat rectum using Galectin 3/Galectin 3/LGALS3 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.||AAA28314_IF6.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human esophageal cancer using Galectin 3/Galectin 3/LGALS3 Rabbit pAb at dilution of 1:100 (40x lens).||AAA28314_IHC5.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human colon using Galectin 3/Galectin 3/LGALS3 Rabbit pAb at dilution of 1:100 (40x lens).||AAA28314_IHC4.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded rat colon using Galectin 3/Galectin 3/LGALS3 Rabbit pAb at dilution of 1:100 (40x lens).||AAA28314_IHC3.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded rat lung using Galectin 3/Galectin 3/LGALS3 Rabbit pAb at dilution of 1:100 (40x lens).||AAA28314_IHC2.jpg!!WB (Western Blot)||Western blot analysis of extracts of various cell lines, using Galectin 3/Galectin 3/LGALS3 antibody at 1:1000 dilution.<br />Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.<br />Lysates/proteins: 25ug per lane.<br />Blocking buffer: 3% nonfat dry milk in TBST.<br />Detection: ECL Basic Kit (RM00020).<br />Exposure time: 30s.||AAA28314_WB.jpg
⇄⧉etc_term1 => string (234) "Immunogen||Recombinant fusion protein containing a sequence corresponding to...
$value['etc_term1']
Immunogen||Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human Galectin 3/Galectin 3/LGALS3 (NP_002297.2).!!Cellular Location||Cytoplasm, Nucleus, Secreted!!Positive Samples||HT-29, A-549, MCF7
⇄⧉products_description => string (775) "Background: This gene encodes a member of the galectin family of carbohydrat...
$value['products_description']
Background: This gene encodes a member of the galectin family of carbohydrate binding proteins. Members of this protein family have an affinity for beta-galactosides. The encoded protein is characterized by an N-terminal proline-rich tandem repeat domain and a single C-terminal carbohydrate recognition domain. This protein can self-associate through the N-terminal domain allowing it to bind to multivalent saccharide ligands. This protein localizes to the extracellular matrix, the cytoplasm and the nucleus. This protein plays a role in numerous cellular functions including apoptosis, innate immunity, cell adhesion and T-cell regulation. The protein exhibits antimicrobial activity against bacteria and fungi. Alternate splicing results in multiple transcript variants.
⇄⧉testing_protocols => string (1732) "IF (Immunofluorescence)||Immunofluorescence analysis of mouse colon using Ga...
$value->a['testing_protocols']
IF (Immunofluorescence)||Immunofluorescence analysis of mouse colon using Galectin 3/Galectin 3/LGALS3 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.||AAA28314_IF8.jpg!!IF (Immunofluorescence)||Immunofluorescence analysis of human colon carcinoma using Galectin 3/Galectin 3/LGALS3 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.||AAA28314_IF7.jpg!!IF (Immunofluorescence)||Immunofluorescence analysis of rat rectum using Galectin 3/Galectin 3/LGALS3 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.||AAA28314_IF6.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human esophageal cancer using Galectin 3/Galectin 3/LGALS3 Rabbit pAb at dilution of 1:100 (40x lens).||AAA28314_IHC5.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human colon using Galectin 3/Galectin 3/LGALS3 Rabbit pAb at dilution of 1:100 (40x lens).||AAA28314_IHC4.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded rat colon using Galectin 3/Galectin 3/LGALS3 Rabbit pAb at dilution of 1:100 (40x lens).||AAA28314_IHC3.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded rat lung using Galectin 3/Galectin 3/LGALS3 Rabbit pAb at dilution of 1:100 (40x lens).||AAA28314_IHC2.jpg!!WB (Western Blot)||Western blot analysis of extracts of various cell lines, using Galectin 3/Galectin 3/LGALS3 antibody at 1:1000 dilution.<br />Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.<br />Lysates/proteins: 25ug per lane.<br />Blocking buffer: 3% nonfat dry milk in TBST.<br />Detection: ECL Basic Kit (RM00020).<br />Exposure time: 30s.||AAA28314_WB.jpg
⇄⧉etc_term1 => string (234) "Immunogen||Recombinant fusion protein containing a sequence corresponding to...
$value->a['etc_term1']
Immunogen||Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human Galectin 3/Galectin 3/LGALS3 (NP_002297.2).!!Cellular Location||Cytoplasm, Nucleus, Secreted!!Positive Samples||HT-29, A-549, MCF7
⇄⧉products_description => string (775) "Background: This gene encodes a member of the galectin family of carbohydrat...
$value->a['products_description']
Background: This gene encodes a member of the galectin family of carbohydrate binding proteins. Members of this protein family have an affinity for beta-galactosides. The encoded protein is characterized by an N-terminal proline-rich tandem repeat domain and a single C-terminal carbohydrate recognition domain. This protein can self-associate through the N-terminal domain allowing it to bind to multivalent saccharide ligands. This protein localizes to the extracellular matrix, the cytoplasm and the nucleus. This protein plays a role in numerous cellular functions including apoptosis, innate immunity, cell adhesion and T-cell regulation. The protein exhibits antimicrobial activity against bacteria and fungi. Alternate splicing results in multiple transcript variants.
⇄⧉testing_protocols => string (1732) "IF (Immunofluorescence)||Immunofluorescence analysis of mouse colon using Ga...
$value->d['testing_protocols']
IF (Immunofluorescence)||Immunofluorescence analysis of mouse colon using Galectin 3/Galectin 3/LGALS3 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.||AAA28314_IF8.jpg!!IF (Immunofluorescence)||Immunofluorescence analysis of human colon carcinoma using Galectin 3/Galectin 3/LGALS3 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.||AAA28314_IF7.jpg!!IF (Immunofluorescence)||Immunofluorescence analysis of rat rectum using Galectin 3/Galectin 3/LGALS3 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.||AAA28314_IF6.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human esophageal cancer using Galectin 3/Galectin 3/LGALS3 Rabbit pAb at dilution of 1:100 (40x lens).||AAA28314_IHC5.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human colon using Galectin 3/Galectin 3/LGALS3 Rabbit pAb at dilution of 1:100 (40x lens).||AAA28314_IHC4.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded rat colon using Galectin 3/Galectin 3/LGALS3 Rabbit pAb at dilution of 1:100 (40x lens).||AAA28314_IHC3.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded rat lung using Galectin 3/Galectin 3/LGALS3 Rabbit pAb at dilution of 1:100 (40x lens).||AAA28314_IHC2.jpg!!WB (Western Blot)||Western blot analysis of extracts of various cell lines, using Galectin 3/Galectin 3/LGALS3 antibody at 1:1000 dilution.<br />Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.<br />Lysates/proteins: 25ug per lane.<br />Blocking buffer: 3% nonfat dry milk in TBST.<br />Detection: ECL Basic Kit (RM00020).<br />Exposure time: 30s.||AAA28314_WB.jpg
⇄⧉etc_term1 => string (234) "Immunogen||Recombinant fusion protein containing a sequence corresponding to...
$value->d['etc_term1']
Immunogen||Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human Galectin 3/Galectin 3/LGALS3 (NP_002297.2).!!Cellular Location||Cytoplasm, Nucleus, Secreted!!Positive Samples||HT-29, A-549, MCF7
⇄⧉products_description => string (775) "Background: This gene encodes a member of the galectin family of carbohydrat...
$value->d['products_description']
Background: This gene encodes a member of the galectin family of carbohydrate binding proteins. Members of this protein family have an affinity for beta-galactosides. The encoded protein is characterized by an N-terminal proline-rich tandem repeat domain and a single C-terminal carbohydrate recognition domain. This protein can self-associate through the N-terminal domain allowing it to bind to multivalent saccharide ligands. This protein localizes to the extracellular matrix, the cytoplasm and the nucleus. This protein plays a role in numerous cellular functions including apoptosis, innate immunity, cell adhesion and T-cell regulation. The protein exhibits antimicrobial activity against bacteria and fungi. Alternate splicing results in multiple transcript variants.
⇄⧉products_description => string (1501) "Intended Uses: This SNCalpha ELISA kit is a 1.5 hour solid-phase ELISA desig...
$value[0]['_source']['products_description']
Intended Uses: This SNCalpha ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Guinea pig SNCalpha. This ELISA kit for research use only!<br><br>Principle of the Assay: SNCalpha ELISA kit applies the quantitative sandwich enzyme immunoassay technique. The microtiter plate has been pre-coated with a monoclonal antibody specific for SNCalpha. Standards or samples are then added to the microtiter plate wells and SNCalpha if present, will bind to the antibody pre-coated wells. In order to quantitatively determine the amount of SNC alpha present in the sample, a standardized preparation of horseradish peroxidase (HRP)-conjugated polyclonal antibody, specific for SNCalpha are added to each well to "sandwich" the SNCalpha immobilized on the plate. The microtiter plate undergoes incubation, and then the wells are thoroughly washed to remove all unbound components. Next, substrate solutions are added to each well. The enzyme (HRP) and substrate are allowed to react over a short incubation period. Only those wells that contain SNCalpha and enzyme-conjugated antibody will exhibit a change in color. The enzyme-substrate reaction is terminated by addition of a sulphuric acid solution and the color change is measured spectrophotometrically at a wavelength of 450 nm. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The SNCalpha concentration in each sample is interpolated from this standard curve.
⇄products_references => string (3) "N/A"
$value[0]['_source']['products_references']
⇄⧉products_related_diseases => string (228) "Nervous System Diseases||912!!Neurodegenerative Diseases||893!!Parkinsonian ...
$value[0]['_source']['products_related_diseases']
Nervous System Diseases||912!!Neurodegenerative Diseases||893!!Parkinsonian Disorders||712!!Parkinson Disease||647!!Lewy Body Disease||251!!Atrophy||152!!Death||152!!Nerve Degeneration||151!!Alzheimer Disease||122!!Neoplasms||50
⇄⧉specificity => string (391) "This assay has high sensitivity and excellent specificity for detection of S...
$value[1]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of SNCOalpha. No significant cross-reactivity or interference between SNCOalpha and analogues was observed. NOTE: Limited by current skills and knowledge, it is impossible for us to complete the cross-reactivity detection between SNCOalpha and all the analogues, therefore, cross reaction may still exist in some cases.
⇄purity => string (3) "N/A"
$value[1]['_source']['purity']
⇄form => string (3) "N/A"
$value[1]['_source']['form']
⇄concentration => string (3) "N/A"
$value[1]['_source']['concentration']
⇄storage_stability => string (35) "Store all reagents at 2-8 degree C."
⇄products_name_syn => string (36) "Mouse a Synuclein oligomer ELISA Kit"
$value[1]['_source']['products_name_syn']
⇄products_gene_name => string (10) "alpha-SYNo"
$value[1]['_source']['products_gene_name']
⇄products_gene_name_syn => string (6) "a-SYNo"
$value[1]['_source']['products_gene_name_syn']
⇄⧉products_description => string (1553) "Principle of the Assay: SNCOalpha ELISA kit applies the quantitative sandwic...
$value[1]['_source']['products_description']
Principle of the Assay: SNCOalpha ELISA kit applies the quantitative sandwich enzyme immunoassay technique. The microtiter plate has been pre-coated with a monoclonal antibody specific for SNCOalpha. Standards or samples are then added to the microtiter plate wells and SNCOalpha if present, will bind to the antibody pre-coated wells. In order to quantitatively determine the amount of SNCOalpha present in the sample, a standardized preparation of horseradish peroxidase (HRP)-conjugated polyclonal antibody, specific for SNCOalpha are added to each well to "sandwich" the SNCOalpha immobilized on the plate. The microtiter plate undergoes incubation, and then the wells are thoroughly washed to remove all unbound components. Next, substrate solutions are added to each well. The enzyme (HRP) and substrate are allowed to react over a short incubation period. Only those wells that contain SNCOalpha and enzyme-conjugated antibody will exhibit a change in color. The enzyme-substrate reaction is terminated by addition of a sulphuric acid solution and the color change is measured spectrophotometrically at a wavelength of 450 nm. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The SNCOalpha concentration in each sample is interpolated from this standard curve.<br><br>Intended Uses: This SNCOalpha ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Mouse SNCOalpha. This ELISA kit for research use only, not for therapeutic or diagnostic applications!
⇄products_references => string (3) "N/A"
$value[1]['_source']['products_references']
⇄⧉products_related_diseases => string (286) "Nervous System Diseases||1126!!Brain Diseases||1106!!Neurodegenerative Disea...
$value[1]['_source']['products_related_diseases']
Nervous System Diseases||1126!!Brain Diseases||1106!!Neurodegenerative Diseases||1095!!Movement Disorders||967!!Parkinsonian Disorders||896!!Parkinson Disease||843!!Lewy Body Disease||278!!Nerve Degeneration||164!!Disease Models, Animal||140!!PARKINSON DISEASE 1, AUTOSOMAL DOMINANT||56
⇄⧉search_terms => string (699) "aaa16191 mouse this assay has high sensitivity and excellent specificity for...
$value[1]['_source']['search_terms']
aaa16191 mouse this assay has high sensitivity and excellent specificity for detection of sncoalpha no significant cross reactivity or interference between analogues was observed note limited by current skills knowledge it is impossible us to complete the all therefore reaction may still exist in some cases typical testing data standard curve reference only aaa16191_sc elisa kit alpha synuclein oligomer a syno non a4 component amyloid precursor snca pd1 nacp park1 park4 140 beta ad 13,109 da syua_human 586067 p37840.1 p37840 q13701 q4jhi3 q6iau6 a8k2a4 605543 neurobiology samples serum plasma cell culture supernatants body fluid tissue homogenate type quantitative sandwich 1.0pg ml park4140
⇄⧉specificity => string (391) "This assay has high sensitivity and excellent specificity for detection of S...
$value[2]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of SNCOalpha. No significant cross-reactivity or interference between SNCOalpha and analogues was observed. NOTE: Limited by current skills and knowledge, it is impossible for us to complete the cross-reactivity detection between SNCOalpha and all the analogues, therefore, cross reaction may still exist in some cases.
⇄purity => string (3) "N/A"
$value[2]['_source']['purity']
⇄form => string (3) "N/A"
$value[2]['_source']['form']
⇄concentration => string (3) "N/A"
$value[2]['_source']['concentration']
⇄storage_stability => string (35) "Store all reagents at 2-8 degree C."
⇄products_name_syn => string (34) "Rat a Synuclein oligomer ELISA Kit"
$value[2]['_source']['products_name_syn']
⇄products_gene_name => string (10) "alpha-SYNo"
$value[2]['_source']['products_gene_name']
⇄products_gene_name_syn => string (6) "a-SYNo"
$value[2]['_source']['products_gene_name_syn']
⇄⧉products_description => string (1446) "Intended Uses: This SNCOalpha ELISA kit is a 1.5 hour solid-phase ELISA desi...
$value[2]['_source']['products_description']
Intended Uses: This SNCOalpha ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Rat SNCOalpha. This ELISA kit for research use only, not for therapeutic or test applications!<br><br>Principle of the Assay: SNCOalpha ELISA kit applies the competitive enzyme immunoassay technique utilizing a polyclonal anti-SNCOalpha antibody and an SNCOalpha-HRP conjugate. The assay sample and buffer are incubated together with SNCOalpha-HRP conjugate in pre-coated plate for one hour. After the incubation period, the wells are decanted and washed five times. The wells are then incubated with a substrate for HRP enzyme. The product of the enzyme-substrate reaction forms a blue colored complex. Finally, a stop solution is added to stop the reaction, which will then turn the solution yellow. The intensity of color is measured spectrophotometrically at 450nm in a microplate reader. The intensity of the color is inversely proportional to the SNCOalpha concentration since SNCOalpha from samples and SNCOalpha-HRP conjugate compete for the anti-SNCOalpha antibody binding site. Since the number of sites is limited, as more sites are occupied by SNCOalpha from the sample, fewer sites are left to bind SNCOalpha-HRP conjugate. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The SNCOalpha concentration in each sample is interpolated from this standard curve.
⇄products_references => string (3) "N/A"
$value[2]['_source']['products_references']
⇄⧉products_related_diseases => string (286) "Nervous System Diseases||1126!!Brain Diseases||1106!!Neurodegenerative Disea...
$value[2]['_source']['products_related_diseases']
Nervous System Diseases||1126!!Brain Diseases||1106!!Neurodegenerative Diseases||1095!!Movement Disorders||967!!Parkinsonian Disorders||896!!Parkinson Disease||843!!Lewy Body Disease||278!!Nerve Degeneration||164!!Disease Models, Animal||140!!PARKINSON DISEASE 1, AUTOSOMAL DOMINANT||56
⇄⧉search_terms => string (716) "aaa16651 rat this assay has high sensitivity and excellent specificity for d...
$value[2]['_source']['search_terms']
aaa16651 rat this assay has high sensitivity and excellent specificity for detection of sncoalpha no significant cross reactivity or interference between analogues was observed note limited by current skills knowledge it is impossible us to complete the all therefore reaction may still exist in some cases typical testing data standard curve reference only aaa16651_sc elisa kit alpha synuclein oligomer a syno non a4 component amyloid precursor snca pd1 nacp park1 park4 140 beta ad 13,109 da syua_human 586067 p37840.1 p37840 q13701 q4jhi3 q6iau6 a8k2a4 605543 neurobiology samples serum plasma cell culture supernatants body fluid tissue homogenate type quantitative competitive 1.0 pg ml park4140 competitive1.0
⇄⧉testing_protocols => string (1378) "FCM (Flow Cytometry)||Flow cytometric analysis of Hela cells with alpha+beta...
$value[3]['_source']['testing_protocols']
FCM (Flow Cytometry)||Flow cytometric analysis of Hela cells with alpha+beta Synuclein antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.||AAA30106_FCM6.jpg!!ICC (Immunocytochemistry)||ICC staining alpha+beta Synuclein in SH-SY-5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.||AAA30106_ICC5.jpg!!ICC (Immunocytochemistry)||ICC staining alpha+beta Synuclein in N2A cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.||AAA30106_ICC4.jpg!!ICC (Immunocytochemistry)||ICC staining alpha+beta Synuclein in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.||AAA30106_ICC3.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded mouse brain tissue using anti-alpha+beta Synuclein antibody. Counter stained with hematoxylin.||AAA30106_IHC2.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded rat brain tissue using anti-alpha+beta Synuclein antibody. Counter stained with hematoxylin.||AAA30106_IHC.jpg
⇄⧉products_name_syn => string (236) "Alpha synuclein antibody; Beta synuclein antibody; NACP antibody; Non A beta...
$value[3]['_source']['products_name_syn']
Alpha synuclein antibody; Beta synuclein antibody; NACP antibody; Non A beta component of AD amyloid antibody; PARK1 antibody; PARK4 antibody; PD1 antibody; SNCA antibody; SNCB antibody; Synuclein alpha antibody; Synuclein beta antibody
⇄products_gene_name => string (3) "N/A"
$value[3]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[3]['_source']['products_gene_name_syn']
⇄⧉products_description => string (854) "The synucleins, including alpha-synuclein (also designated NACP for nonamylo...
$value[3]['_source']['products_description']
The synucleins, including alpha-synuclein (also designated NACP for nonamyloid component precursor), beta-synuclein (also designated PNP 14 for phospho-neuroprotein 14) and gamma-synuclein (also designated persyn or BCSG1 for breast cancer-specific gene 1) are presynaptic proteins abundant in neurons. Synucleins are predominantly expressed in the brain and are speculated to be involved in synaptic regulation and neuronal plasticity. alpha-Synuclein, identified as a component of Alzheimers disease amyloid plaques, is localized to neuronal cell bodies and synapses. Coordinate expression of alpha-synuclein and beta-synuclein may be important during hematopoetic cell differentiation. A mutant form of alpha-synuclein is found in patients with early onset Parkinsons disease. gamma-Synuclein is associated with axonal pathology in Parkinsons disease.
⇄products_references => string (3) "N/A"
$value[3]['_source']['products_references']
⇄⧉products_related_diseases => string (260) "Nervous System Diseases||1049!!Brain Diseases||1028!!Neurodegenerative Disea...
$value[3]['_source']['products_related_diseases']
Nervous System Diseases||1049!!Brain Diseases||1028!!Neurodegenerative Diseases||1016!!Movement Disorders||896!!Parkinsonian Disorders||829!!Parkinson Disease||755!!Lewy Body Disease||270!!Nerve Degeneration||160!!Disease Models, Animal||127!!Drug Toxicity||71
⇄products_categories => string (16) "Total protein Ab"
⇄⧉search_terms => string (1095) "aaa30106 rabbit human mouse rat monoclonal st05 21 proa affinity purified 1*...
$value[3]['_source']['search_terms']
aaa30106 rabbit human mouse rat monoclonal st05 21 proa affinity purified 1*tbs ph7.4 1 bsa 40 glycerol preservative 0.05 sodium azide western blot wb immunocytochemistry icc immunofluorescence if immunohistochemistry ihc flow cytometry fc facs 1:1000 1:2000 1:50 1:200 1:100 immunohistochemical analysis of paraffin embedded brain tissue using anti alpha+beta synuclein antibody counter stained with hematoxylin aaa30106_ihc aaa30106_ihc2 staining in hela cells green the nuclear stain is dapi blue were fixed paraformaldehyde permeabilised 0.25 triton x100 pbs aaa30106_icc3 n2a aaa30106_icc4 sh sy 5y aaa30106_icc5 cytometric at 50 dilution red compared an unlabelled control without incubation primary black alexa fluor 488 conjugated goat igg was used as secondary aaa30106_fc6 alpha beta nacp non a component ad amyloid park1 park4 pd1 snca sncb isoform nacp140 a4 precursor 140 14,460 da syua_human 4507109 np_000336.1 p37840 nm_000345.3 q13701 q4jhi3 q6iau6 a8k2a4 127750 total protein ab type recombinant immunogen conjugation unconjugated st0521 ph7.41 bsa40 at50 fluor488 precursor140
ICC (Immunocytochemistry)||ICC staining Phospho-alpha Synuclein (S129) in SH-SY-5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.||AAA29788_ICC6.jpg!!ICC (Immunocytochemistry)||ICC staining Phospho-alpha Synuclein (S129) in HUVEC cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.||AAA29788_ICC5.jpg!!ICC (Immunocytochemistry)||ICC staining Phospho-alpha Synuclein (S129) in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.||AAA29788_ICC4.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded mouse brain tissue using anti-Phospho-alpha Synuclein (S129) antibody. Counter stained with hematoxylin.||AAA29788_IHC3.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded human kidney tissue using anti-Phospho-alpha Synuclein (S129) antibody. Counter stained with hematoxylin.||AAA29788_IHC2.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded rat brain tissue using anti-Phospho-alpha Synuclein (S129) antibody. Counter stained with hematoxylin.||AAA29788_IHC.jpg
Alpha synuclein antibody; Alpha-synuclein antibody; Alpha-synuclein; isoform NACP140 antibody; alphaSYN antibody; MGC105443 antibody; MGC110988 antibody; MGC127560 antibody; MGC64356 antibody; NACP antibody; Non A beta component of AD amyloid antibody; Non A4 component of amyloid antibody; Non A4 component of amyloid precursor antibody; Non-A beta component of AD amyloid antibody; Non-A-beta component of alzheimers disease amyloid; precursor of antibody; Non-A4 component of amyloid precursor antibody; Non-A4 component of amyloid; precursor of antibody; OTTHUMP00000218549 antibody; OTTHUMP00000218551 antibody; OTTHUMP00000218552 antibody; OTTHUMP00000218553 antibody; OTTHUMP00000218554 antibody; PARK 1 antibody; PARK 4 antibody; PARK1 antibody; PARK4 antibody; Parkinson disease (autosomal dominant; Lewy body) 4 antibody; Parkinson disease familial 1 antibody; SNCA antibody; Snca synuclein; alpha (non A4 component of amyloid precursor) antibody; SYN antibody; Synuclein alpha antibody; Synuclein alpha 140 antibody; Synuclein; alpha (non A4 component of amyloid precursor) antibody; SYUA_HUMAN antibody
⇄products_gene_name => string (3) "N/A"
$value[4]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[4]['_source']['products_gene_name_syn']
⇄⧉products_description => string (820) "The synuclein family members, including alpha-synuclein (also designated NAC...
$value[4]['_source']['products_description']
The synuclein family members, including alpha-synuclein (also designated NACP for non-beta-Amyloid component) and beta-synuclein, are predominantly expressed in the brain and are speculated to be involved in synaptic regulation and neuronal plasticity. alpha-synuclein is localized to neuronal cell bodies and synapses. alpha-synuclein was first identified as a component of Alzheimer's disease amyloid plaques. Abnormal platelet function in Alzheimer's disease has been demonstrated. During megakaryocytic differentiation alpha-synuclein has been found to be upregulated, while beta-synuclein is downregulated, indicating that coordinate expression of synucleins may be important during hematopoetic cell differentiation. A mutant form of alpha-synuclein has been found in patients with early onset Parkinson's disease.
⇄products_references => string (3) "N/A"
$value[4]['_source']['products_references']
⇄⧉products_related_diseases => string (260) "Nervous System Diseases||1049!!Brain Diseases||1028!!Neurodegenerative Disea...
$value[4]['_source']['products_related_diseases']
Nervous System Diseases||1049!!Brain Diseases||1028!!Neurodegenerative Diseases||1016!!Movement Disorders||896!!Parkinsonian Disorders||829!!Parkinson Disease||755!!Lewy Body Disease||270!!Nerve Degeneration||160!!Disease Models, Animal||127!!Drug Toxicity||71
⇄⧉storage_stability => string (194) "Store at -80 degree C; 1 year + Avoid freeze/thaw cycles. <br>Shipping Tempe...
$value[5]['_source']['storage_stability']
Store at -80 degree C; 1 year + Avoid freeze/thaw cycles. <br>Shipping Temperature: Dry Ice.<br>Shipping note: Product will be shipped separately from other products purchased in the same order.
⇄app_tested => string (58) "Western Blot (WB), SDS-PAGE, In vivo assay, In vitro assay"
$value[5]['_source']['app_tested']
⇄app_notes => string (3) "N/A"
$value[5]['_source']['app_notes']
⇄⧉testing_protocols => string (1184) "SDS-PAGE||SDS-PAGE of ~14 kDa Active Human Recombinant Alpha Synuclein Prote...
$value[5]['_source']['testing_protocols']
SDS-PAGE||SDS-PAGE of ~14 kDa Active Human Recombinant Alpha Synuclein Protein Monomer (SPR-321). Lane 1: Molecular Weight Ladder (MW). Lane 2: BSA (5 ug). Lane 3: BSA (2.5 ug). Lane 4: Active Alpha Synuclein Protein Monomer (5 ug) (SPR-321). Lane 5: Active Alpha Synuclein Protein Monomer (2.5 ug) (SPR-321).||AAA27658_SDS_PAGE2.png!!Application Data||Active alpha synuclein aggregate (SPR-322) seeds the formation of new alpha Synuclein aggregates from the pool of active alpha Synuclein monomers (SPR-321). Thioflavin T is a fluorescent dye that binds to beta sheet-rich structures, such as those in alpha Synuclein aggregates. Upon binding, the emission spectrum of the dye experiences a red-shift, and increased fluorescence intensity. Thioflavin T emission curves show increased fluorescence (correlated to alpha Synuclein protein aggregation) over time when 10 nM of active alpha Synuclein aggregate (SPR-322) is combined with 100 uM of active alpha Synuclein monomer (SPR-321), as compared to when 100 uM of control alpha Synuclein monomer (SPR-316) is combined with 10 nM of active alpha Synuclein aggregate (SPR-322). Thioflavin T ex = 450 nm, em = 485 nm.||AAA27658_APP.png
Species||Human!!Target||Alpha Synuclein!!Cellular Localization||Cytoplasm; Membrane; Nucleus!!Storage Buffer||PBS pH 7.4!!Biological Activity||100 uM alpha synuclein protein monomer seeded with 10 nM alpha synuclein protein aggregate in 25 uM Thioflavin T (PBS pH 7.4, 100 ul reaction volume) generated a fluorescence intensity of 13,000 Relative Fluorescence Units after incubation at 37 degree C with shaking at 600 rpm for 24 hours. Fluorescence was measured by excitation at 450 nm and emission at 485 nm on a Molecular Devices Gemini XPS microplate reader.!!Nature||Recombinant
⇄⧉etc_term2 => string (276) "Tag Information||No tag!!Dry Ice Shipment||Extra charge fee may add to your ...
$value[5]['_source']['etc_term2']
Tag Information||No tag!!Dry Ice Shipment||Extra charge fee may add to your shipping cost as dry ice is required to ship this product.!!Research Areas||Alzheimer's Disease, Neurodegeneration, Neuroscience, Parkinson's Disease, Synuclein, Tangles & Tau, Multiple System Atrophy
⇄⧉products_name_syn => string (455) "Active Human Recombinant Alpha Synuclein Protein Monomer; Active Alpha synuc...
$value[5]['_source']['products_name_syn']
Active Human Recombinant Alpha Synuclein Protein Monomer; Active Alpha synuclein monomer; Active Alpha-synuclein monomer; Active Alpha synuclein protein monomer; Active Alpha synuclein monomer; Active Alpha-synuclein protein; Non-A beta component of AD amyloid protein; Non-A4 component of amyloid precursor protein; NACP protein; SNCA protein; NACP protein; PARK1 protein; Active Alpha synuclein monomers; SYN protein; Parkison disease familial 1 Protein
⇄products_gene_name => string (3) "N/A"
$value[5]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[5]['_source']['products_gene_name_syn']
⇄⧉products_description => string (926) "Alpha-Synuclein (SNCA) is expressed predominantly in the brain, where it is ...
$value[5]['_source']['products_description']
Alpha-Synuclein (SNCA) is expressed predominantly in the brain, where it is concentrated in presynaptic nerve terminals (1). Alpha-synuclein is highly expressed in the mitochondria of the olfactory bulb, hippocampus, striatum and thalamus (2). Functionally, it has been shown to significantly interact with tubulin (3), and may serve as a potential microtubule-associated protein. It has also been found to be essential for normal development of the cognitive functions; inactivation may lead to impaired spatial learning and working memory (4).<br>SNCA fibrillar aggregates represent the major non A-beta component of Alzheimers disease amyloid plaque, and a major component of Lewy body inclusions, and Parkinson's disease. Parkinson's disease (PD) is a common neurodegenerative disorder characterized by the progressive accumulation in selected neurons of protein inclusions containing alpha-synuclein and ubiquitin (5, 6).
⇄⧉products_references => string (388) "1. "Genetics Home Reference: SNCA". US National Library of Medicine. (2013)....
$value[5]['_source']['products_references']
1. "Genetics Home Reference: SNCA". US National Library of Medicine. (2013). 2. Zhang L., et al. (2008) Brain Res. 1244: 40-52. 3. Alim M.A., et al. (2002) J Biol Chem. 277(3): 2112-2117. 4. Kokhan V.S., Afanasyeva M.A., Van'kin G. (2012) Behav. Brain. Res. 231(1): 226-230. 5. Spillantini M.G., et al. (1997) Nature. 388(6645): 839-840. 6. Mezey E., et al. (1998) Nat Med. 4(7): 755-757.
⇄⧉products_related_diseases => string (289) "Nervous System Diseases||1519!!Brain Diseases||1496!!Neurodegenerative Disea...
$value[5]['_source']['products_related_diseases']
Nervous System Diseases||1519!!Brain Diseases||1496!!Neurodegenerative Diseases||1472!!Movement Disorders||1321!!Parkinsonian Disorders||1215!!Parkinson Disease||1176!!Lewy Body Disease||336!!Disease Models, Animal||219!!Nerve Degeneration||182!!PARKINSON DISEASE 1, AUTOSOMAL DOMINANT||70
⇄⧉search_terms => string (1454) "aaa27658 e coli >95 ion exchange purified ~14.46 kda western blot wb sds pag...
$value[5]['_source']['search_terms']
aaa27658 e coli >95 ion exchange purified ~14.46 kda western blot wb sds page in vivo assay vitro testing data active alpha synuclein aggregate spr 322 seeds the formation of new aggregates from pool monomers 321 thioflavin t is a fluorescent dye that binds to beta sheet rich structures such as those upon binding emission spectrum experiences red shift and increased fluorescence intensity curves show correlated protein aggregation over time when 10 nm combined with 100 um monomer compared control 316 ex = 450 em 485 aaa27658_td ~14 human recombinant lane 1 molecular weight ladder mw 2 bsa 5 ug 3 2.5 4 aaa27658_sds2 mdvfmkglskakegvvaaaektkqgvaeaagktkegvlyvgsktkegvvhgvatvaektkeqvtnvggavvtgvtavaqktvegagsiaaatgfvkkdqlgkneegapqegiledmpvdpdneayempseegyqdyepea non component ad amyloid a4 precursor nacp snca park1 syn parkison disease familial isoform nacp140 pd1 park4 13,109 da 4507109 np_000336.1 p37840 nm_000345.3 q13701 q4jhi3 q6iau6 a8k2a4 127750 neuroscience neurodegeneration alzheimer's tangles tau parkinson's species target cellular localization cytoplasm membrane nucleus storage buffer pbs ph 7.4 biological activity seeded 25 ul reaction volume generated 13,000 relative units after incubation at 37 degree c shaking 600 rpm for 24 hours was measured by excitation on devices gemini xps microplate reader tag information no spr322 monomers321 when10 with100 control316 =450 em485 lane1 mw2 bsa5 ug3 ph7.4 seeded25 at37 shaking600 for24
⇄⧉specificity => string (201) "Binds within the 81-130 aa region of human alpha synuclein, determined using...
$value[6]['_source']['specificity']
Binds within the 81-130 aa region of human alpha synuclein, determined using WB and ELISA with corresponding peptides. Detects ~14 kDa band corresponding to Alpha synuclein. Band at ~30 kDa is a dimer.
WB: 1:1000<br>DB: 1:1000<br>ICC/IF: 1:100<br>ELISA: 1:1000<br><br>A 1:1000 dilution of SMC-530 was sufficient for detection of Alpha Synuclein in 15 ug of human brain cell lysate by ECL immunoblot analysis using goat anti-mouse IgG:HRP as the secondary antibody.<br><br>Optimal dilutions for assays should be determined by the end user
⇄⧉testing_protocols => string (2036) "WB (Western Blot)||Western Blot analysis of Mouse, Rat Brain showing detecti...
$value[6]['_source']['testing_protocols']
WB (Western Blot)||Western Blot analysis of Mouse, Rat Brain showing detection of 14 kDa Alpha Synuclein protein using Mouse Anti-Alpha Synuclein Monoclonal Antibody, Clone 3C11. Lane 1: Molecular Weight Ladder (MW). Lane 2: Mouse brain cell lysate. Lane 3: Rat brain cell lysate. Load: 15 ug. Block: 5% Skim Milk in 1X TBST. Primary Antibody: Mouse Anti-Alpha Synuclein Monoclonal Antibody at 1:1000 for 2 hours at RT. Secondary Antibody: Goat Anti-Mouse HRP:IgG at 1:3000 for 1 hour at RT. Color Development: ECL solution (Super Signal West Pico) for 5 min in RT. Predicted/Observed Size: 14 kDa. Other Band(s): ~30 kDa (dimer).||AAA17810_WB3.png!!WB (Western Blot)||Western Blot analysis of Human Brain showing detection of 14 kDa Alpha Synuclein protein using Mouse Anti-Alpha Synuclein Monoclonal Antibody, Clone 3C11. Lane 1: Molecular Weight Ladder (MW). Lane 2: Parkinson brain cell lystate. Lane 3: Human brain cell lysate. Load: 15 ug. Block: 5% Skim Milk in 1X TBST. Primary Antibody: Mouse Anti-Alpha Synuclein Monoclonal Antibody at 1:1000 for 2 hours at RT. Secondary Antibody: Goat Anti-Mouse HRP:IgG at 1:3000 for 1 hour at RT. Color Development: ECL solution (Super Signal West Pico) for 5 min in RT. Predicted/Observed Size: 14 kDa. Other Band(s): 100 kDa (oligomer).||AAA17810_WB2.png!!ICC (Immunocytochemistry)||Immunocytochemistry/Immunofluorescence analysis using Mouse Anti-Alpha Synuclein Monoclonal Antibody, Clone 3C11. Tissue: Neuroblastoma cell line (SK-N-BE). Species: Human. Fixation: 4% Formaldehyde for 15 min at RT. Primary Antibody: Mouse Anti-Alpha Synuclein Monoclonal Antibody at 1:100 for 60 min at RT. Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1:200 for 60 min at RT. Counterstain: Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1:1000, 1:5000 for 60 min at RT, 5 min at RT. Localization: Cytoplasm: weak; Nucleus: Med. Magnification: 60X. (A) DAPI (blue) nuclear stain. (B) Phalloidin Texas Red F-Actin stain. (C) Alpha Synuclein Antibody. (D) Composite.||AAA17810_ICC.png
Mouse Anti-Human Alpha Synuclein Monoclonal IgG1; Alpha Synuclein Antibody; Alpha Synuclein Antibody; Non-A beta component of AD amyloid Antibody; Non-A4 component of amyloid precursor Antibody; NACP Antibody; SNCA Antibody; PARK1 Antibody; PARK 1 Antibody; alphaSYN Antibody; PARK 4 antibody; PARK4 antibody; Parkinson disease familial 1 antibody; Parkinson disease (autosomal dominant; Lewy body) 4 antibody; SYN antibody
⇄products_gene_name => string (3) "N/A"
$value[6]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[6]['_source']['products_gene_name_syn']
⇄⧉products_description => string (926) "Alpha-Synuclein (SNCA) is expressed predominantly in the brain, where it is ...
$value[6]['_source']['products_description']
Alpha-Synuclein (SNCA) is expressed predominantly in the brain, where it is concentrated in presynaptic nerve terminals (1). Alpha-synuclein is highly expressed in the mitochondria of the olfactory bulb, hippocampus, striatum and thalamus (2). Functionally, it has been shown to significantly interact with tubulin (3), and may serve as a potential microtubule-associated protein. It has also been found to be essential for normal development of the cognitive functions; inactivation may lead to impaired spatial learning and working memory (4).<br>SNCA fibrillar aggregates represent the major non A-beta component of Alzheimers disease amyloid plaque, and a major component of Lewy body inclusions, and Parkinson's disease. Parkinson's disease (PD) is a common neurodegenerative disorder characterized by the progressive accumulation in selected neurons of protein inclusions containing alpha-synuclein and ubiquitin (5, 6).
⇄⧉products_references => string (388) "1. "Genetics Home Reference: SNCA". US National Library of Medicine. (2013)....
$value[6]['_source']['products_references']
1. "Genetics Home Reference: SNCA". US National Library of Medicine. (2013). 2. Zhang L., et al. (2008) Brain Res. 1244: 40-52. 3. Alim M.A., et al. (2002) J Biol Chem. 277(3): 2112-2117. 4. Kokhan V.S., Afanasyeva M.A., Van'kin G. (2012) Behav. Brain. Res. 231(1): 226-230. 5. Spillantini M.G., et al. (1997) Nature. 388(6645): 839-840. 6. Mezey E., et al. (1998) Nat Med. 4(7): 755-757.
⇄⧉products_related_diseases => string (289) "Nervous System Diseases||1519!!Brain Diseases||1496!!Neurodegenerative Disea...
$value[6]['_source']['products_related_diseases']
Nervous System Diseases||1519!!Brain Diseases||1496!!Neurodegenerative Diseases||1472!!Movement Disorders||1321!!Parkinsonian Disorders||1215!!Parkinson Disease||1176!!Lewy Body Disease||336!!Disease Models, Animal||219!!Nerve Degeneration||182!!PARKINSON DISEASE 1, AUTOSOMAL DOMINANT||70
⇄⧉search_terms => string (1424) "aaa17810 mouse human rat monoclonal igg1 3c11 protein g purified binds withi...
$value[6]['_source']['search_terms']
aaa17810 mouse human rat monoclonal igg1 3c11 protein g purified binds within the 81 130 aa region of alpha synuclein determined using wb and elisa with corresponding peptides detects ~14 kda band to at ~30 is a dimer western blot dot db immunocytochemistry icc immunofluorescence if eia 1:1000 1:100 analysis anti antibody clone tissue neuroblastoma cell line sk n be species fixation 4 formaldehyde for 15 min rt primary 60 secondary goat atto 488 1:200 counterstain phalloidin texas red f actin stain dapi blue nuclear 1:5000 5 localization cytoplasm weak nucleus med magnification 60x b c d composite aaa17810_icc brain showing detection 14 lane 1 molecular weight ladder mw 2 parkinson lystate 3 lysate load ug block skim milk in 1x tbst hours hrp:igg 1:3000 hour color development ecl solution super signal west pico predicted observed size other s 100 oligomer aaa17810_wb2 aaa17810_wb3 non beta component ad amyloid a4 precursor nacp snca park1 park alphasyn park4 disease familial autosomal dominant lewy body syn isoform nacp140 pd1 4507109 np_000336.1 p37840 nm_000345.3 q13701 q4jhi3 q6iau6 a8k2a4 127750 antibodies neuroscience neurodegeneration alzheimer's tangles tau parkinson's immunogen monomer cellular cytosol membrane junction synapse conjugate unconjugated storage buffer pbs ph 7.4 50 glycerol 0.09 sodium azide the81 fixation4 for15 primary60 atto488 1:50005 detection14 lane1 mw2 lystate3 s100 ph7.4
⇄⧉specificity => string (391) "This assay has high sensitivity and excellent specificity for detection of S...
$value[7]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of SNCOalpha. No significant cross-reactivity or interference between SNCOalpha and analogues was observed. NOTE: Limited by current skills and knowledge, it is impossible for us to complete the cross-reactivity detection between SNCOalpha and all the analogues, therefore, cross reaction may still exist in some cases.
⇄purity => string (3) "N/A"
$value[7]['_source']['purity']
⇄form => string (3) "N/A"
$value[7]['_source']['form']
⇄concentration => string (3) "N/A"
$value[7]['_source']['concentration']
⇄storage_stability => string (35) "Store all reagents at 2-8 degree C."
Assay Type||Quantitative Competitive or Sandwich!!Samples||Serum, plasma, cell culture supernatants, body fluid and tissue homogenate!!Sensitivity||0.1 ng/mL
⇄⧉products_description => string (1553) "Principle of the Assay: SNCOalpha ELISA kit applies the quantitative sandwic...
$value[7]['_source']['products_description']
Principle of the Assay: SNCOalpha ELISA kit applies the quantitative sandwich enzyme immunoassay technique. The microtiter plate has been pre-coated with a monoclonal antibody specific for SNCOalpha. Standards or samples are then added to the microtiter plate wells and SNCOalpha if present, will bind to the antibody pre-coated wells. In order to quantitatively determine the amount of SNCOalpha present in the sample, a standardized preparation of horseradish peroxidase (HRP)-conjugated polyclonal antibody, specific for SNCOalpha are added to each well to "sandwich" the SNCOalpha immobilized on the plate. The microtiter plate undergoes incubation, and then the wells are thoroughly washed to remove all unbound components. Next, substrate solutions are added to each well. The enzyme (HRP) and substrate are allowed to react over a short incubation period. Only those wells that contain SNCOalpha and enzyme-conjugated antibody will exhibit a change in color. The enzyme-substrate reaction is terminated by addition of a sulphuric acid solution and the color change is measured spectrophotometrically at a wavelength of 450 nm. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The SNCOalpha concentration in each sample is interpolated from this standard curve.<br><br>Intended Uses: This SNCOalpha ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Human SNCOalpha. This ELISA kit for research use only, not for therapeutic or diagnostic applications!
<a href="http://journals.plos.org/plosone/article?id=10.1371/journal.pone.0151156" rel="nofollow" target="_blank">Abnormal Salivary Total and Oligomeric Alpha-Synuclein in Parkinson's Disease</a>. Giorgio Vivacqua, Anna Latorre, Antonio Suppa, Michela Nardi, Sara Pietracupa, Romina Mancinelli, Giovanni Fabbrini, Carlo Colosimo, Eugenio Gaudio, Alfredo Berardelli (2016)
⇄⧉products_related_diseases => string (286) "Nervous System Diseases||1126!!Brain Diseases||1106!!Neurodegenerative Disea...
$value[7]['_source']['products_related_diseases']
Nervous System Diseases||1126!!Brain Diseases||1106!!Neurodegenerative Diseases||1095!!Movement Disorders||967!!Parkinsonian Disorders||896!!Parkinson Disease||843!!Lewy Body Disease||278!!Nerve Degeneration||164!!Disease Models, Animal||140!!PARKINSON DISEASE 1, AUTOSOMAL DOMINANT||56
⇄⧉search_terms => string (729) "aaa16537 human this assay has high sensitivity and excellent specificity for...
$value[7]['_source']['search_terms']
aaa16537 human this assay has high sensitivity and excellent specificity for detection of sncoalpha no significant cross reactivity or interference between analogues was observed note limited by current skills knowledge it is impossible us to complete the all therefore reaction may still exist in some cases typical testing data standard curve reference only aaa16537_sc elisa kit alpha synuclein oligomer alphasyno non a4 component amyloid precursor snca pd1 nacp park1 park4 140 a beta ad 13,109 da syua_human 586067 p37840.1 p37840 q13701 q4jhi3 q6iau6 a8k2a4 605543 neurobiology samples serum plasma cell culture supernatants body fluid tissue homogenate type quantitative competitive sandwich 0.1 ng ml park4140 sandwich0.1
⇄⧉products_description => string (831) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[8]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Human alpha-SYN monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄products_references => string (3) "N/A"
$value[8]['_source']['products_references']
⇄⧉products_related_diseases => string (228) "Nervous System Diseases||912!!Neurodegenerative Diseases||893!!Parkinsonian ...
$value[8]['_source']['products_related_diseases']
Nervous System Diseases||912!!Neurodegenerative Diseases||893!!Parkinsonian Disorders||712!!Parkinson Disease||647!!Lewy Body Disease||251!!Atrophy||152!!Death||152!!Nerve Degeneration||151!!Alzheimer Disease||122!!Neoplasms||50
⇄sp_protein_name_syn => string (73) "Non-A beta component of AD amyloid; Non-A4 component of amyloid precursor"
$value[8]['_source']['sp_protein_name_syn']
⇄sp_gene_name => string (4) "Snca"
$value[8]['_source']['sp_gene_name']
⇄sp_gene_name_syn => string (3) "Syn"
$value[8]['_source']['sp_gene_name_syn']
⇄sp_entry_name => string (10) "SYUA_MOUSE"
$value[8]['_source']['sp_entry_name']
⇄sp_mim => string (3) "N/A"
$value[8]['_source']['sp_mim']
⇄sp_interactions => string (3) "N/A"
$value[8]['_source']['sp_interactions']
⇄products_url => string (3) "N/A"
$value[8]['_source']['products_url']
⇄products_viewed => string (1) "0"
$value[8]['_source']['products_viewed']
⇄⧉search_terms => string (503) "aaa22495 human no cross reaction with other factors typical testing data sta...
$value[8]['_source']['search_terms']
aaa22495 human no cross reaction with other factors typical testing data standard curve for reference only aaa22495_td elisa kit alpha synuclein syn snca nacp alphasyn non a4 component of amyloid a beta ad 14,485 da precursor syua_mouse 109638747 np_001035916.1 o55042 nm_001042451.1 q3u130 q9cxf8 q9eqc3 q9qur3 samples serum plasma or cell culture supernatant and organizations assay type quantitative sandwich detection range 1000 pg ml 1.56pg sensitivity 5pg intra precision <= 8 inter 12 <=8 inter12
Assay Type||Quantitative Sandwich!!Samples||Serum, plasma, cell culture supernates, Ascites, tissue homogenates or other biological fluids!!Detection Range||10-1000pg/ml!!Sensitivity||5.15pg/ml
⇄⧉etc_term2 => string (403) "Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Thr...
$value[9]['_source']['etc_term2']
Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Three samples of known concentration were tested on one plate to assess intra-assay precision. Intra-Assay: CV<8%!!Inter-assay Precision||Inter-Assay Precision (Precision between assays) Three samples of known concentration were tested in separate assays to assess inter-assay precision. CV(%) = SD/mean x 100. Inter-Assay: CV<10%
⇄⧉products_description => string (882) "Principle of the Assay: This kit is an Enzyme-Linked Immunosorbent Assay (EL...
$value[9]['_source']['products_description']
Principle of the Assay: This kit is an Enzyme-Linked Immunosorbent Assay (ELISA). The plate has been pre-coated with Human SNCA antibody. SNCA present in the sample is added and binds to antibodies coated on the wells. And then biotinylated Human SNCA Antibody is added and binds to SNCA in the sample. Then Streptavidin-HRP is added and binds to the Biotinylated SNCA antibody. After incubation unbound Streptavidin-HRP is washed away during a washing step. Substrate solution is then added and color develops in proportion to the amount of Human SNCA. The reaction is terminated by addition of acidic stop solution and absorbance is measured at 450 nm.<br><br>Intended Uses: This sandwich kit is for the accurate quantitative detection of Human Alpha-Synuclein (also known as SNCA) in serum, plasma, cell culture supernates, Ascites, tissue homogenates or other biological fluids.
⇄products_references => string (3) "N/A"
$value[9]['_source']['products_references']
⇄⧉products_related_diseases => string (260) "Nervous System Diseases||1054!!Brain Diseases||1034!!Neurodegenerative Disea...
$value[9]['_source']['products_related_diseases']
Nervous System Diseases||1054!!Brain Diseases||1034!!Neurodegenerative Diseases||1021!!Movement Disorders||901!!Parkinsonian Disorders||833!!Parkinson Disease||766!!Lewy Body Disease||271!!Nerve Degeneration||162!!Disease Models, Animal||127!!Drug Toxicity||71
⇄⧉sp_protein_name_syn => string (79) "Non-A beta component of AD amyloid; Non-A4 component of amyloid precursor; N...
$value[9]['_source']['sp_protein_name_syn']
Non-A beta component of AD amyloid; Non-A4 component of amyloid precursor; NACP
⇄sp_gene_name => string (4) "Snca"
$value[9]['_source']['sp_gene_name']
⇄sp_gene_name_syn => string (9) "Syn; NACP"
$value[9]['_source']['sp_gene_name_syn']
⇄sp_entry_name => string (3) "N/A"
$value[9]['_source']['sp_entry_name']
⇄sp_mim => string (3) "N/A"
$value[9]['_source']['sp_mim']
⇄sp_interactions => string (3) "N/A"
$value[9]['_source']['sp_interactions']
⇄products_url => string (3) "N/A"
$value[9]['_source']['products_url']
⇄products_viewed => string (1) "0"
$value[9]['_source']['products_viewed']
⇄⧉search_terms => string (515) "aaa11132 human typical testing data standard curve for reference only aaa111...
$value[9]['_source']['search_terms']
aaa11132 human typical testing data standard curve for reference only aaa11132_sc elisa kit alpha synuclein snca nacp alphasyn syn 12,345 da non a beta component of ad amyloid a4 precursor 109638747 np_001035916.1 o55042 nm_001042451.2 q3u130 q9cxf8 q9eqc3 q9qur3 assay type quantitative sandwich detection range 10 1000pg ml sensitivity 5.15pg intra precision within an three samples known concentration were tested on one plate to assess cv<8 inter between assays in separate cv = sd mean x 100 cv<10 range10 x100
⇄⧉specificity => string (388) "This assay has high sensitivity and excellent specificity for detection of S...
$value[10]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of SNCalpha. No significant cross-reactivity or interference between SNCalpha and analogues was observed. NOTE: Limited by current skills and knowledge, it is impossible for us to complete the cross-reactivity detection between SNCalpha and all the analogues, therefore, cross reaction may still exist in some cases.
⇄purity => string (3) "N/A"
$value[10]['_source']['purity']
⇄form => string (3) "N/A"
$value[10]['_source']['form']
⇄concentration => string (3) "N/A"
$value[10]['_source']['concentration']
⇄storage_stability => string (35) "Store all reagents at 2-8 degree C."
⇄products_name_syn => string (25) "Rat a Synuclein ELISA Kit"
$value[10]['_source']['products_name_syn']
⇄products_gene_name => string (9) "alpha-SYN"
$value[10]['_source']['products_gene_name']
⇄products_gene_name_syn => string (5) "a-SYN"
$value[10]['_source']['products_gene_name_syn']
⇄⧉products_description => string (1439) "Principle of the Assay: SNCalpha ELISA kit applies the competitive enzyme im...
$value[10]['_source']['products_description']
Principle of the Assay: SNCalpha ELISA kit applies the competitive enzyme immunoassay technique utilizing a polyclonal anti-SNCalpha antibody and an SNCalpha-HRP conjugate. The assay sample and buffer are incubated together with SNCalpha-HRP conjugate in pre-coated plate for one hour. After the incubation period, the wells are decanted and washed five times. The wells are then incubated with a substrate for HRP enzyme. The product of the enzyme-substrate reaction forms a blue colored complex. Finally, a stop solution is added to stop the reaction, which will then turn the solution yellow. The intensity of color is measured spectrophotometrically at 450nm in a microplate reader. The intensity of the color is inversely proportional to the SNCalpha concentration since SNCalpha from samples and SNCalpha-HRP conjugate compete for the anti-SNCalpha antibody binding site. Since the number of sites is limited, as more sites are occupied by SNCalpha from the sample, fewer sites are left to bind SNCalpha-HRP conjugate. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The SNCalpha concentration in each sample is interpolated from this standard curve.<br><br>Intended Uses: This SNCalpha ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Rat SNCalpha. This ELISA kit for research use only, not for therapeutic or diagnostic applications!
<a href="http://proceedings.itb.ac.id/download.php?file=A12289.pdf&id=1714&up=3" rel="nofollow" target="_blank">Increase of Oxidative Stres ?-Synuclein in Wistar Rat's</a>. Arief Budi Yulianti, Sony Heru Sumarsono, Ahmad Ridwan & Ayda T. Yusuf (2012)
⇄⧉products_related_diseases => string (286) "Nervous System Diseases||1126!!Brain Diseases||1106!!Neurodegenerative Disea...
⇄⧉sp_protein_name_syn => string (79) "Non-A beta component of AD amyloid; Non-A4 component of amyloid precursor; N...
$value[10]['_source']['sp_protein_name_syn']
Non-A beta component of AD amyloid; Non-A4 component of amyloid precursor; NACP
⇄sp_gene_name => string (4) "Snca"
$value[10]['_source']['sp_gene_name']
⇄sp_gene_name_syn => string (9) "Syn; NACP"
$value[10]['_source']['sp_gene_name_syn']
⇄sp_entry_name => string (10) "SYUA_MOUSE"
$value[10]['_source']['sp_entry_name']
⇄sp_mim => string (3) "N/A"
$value[10]['_source']['sp_mim']
⇄sp_interactions => string (3) "N/A"
$value[10]['_source']['sp_interactions']
⇄products_url => string (3) "N/A"
$value[10]['_source']['products_url']
⇄products_viewed => string (1) "0"
$value[10]['_source']['products_viewed']
⇄⧉search_terms => string (702) "aaa16124 rat this assay has high sensitivity and excellent specificity for d...
$value[10]['_source']['search_terms']
aaa16124 rat this assay has high sensitivity and excellent specificity for detection of sncalpha no significant cross reactivity or interference between analogues was observed note limited by current skills knowledge it is impossible us to complete the all therefore reaction may still exist in some cases typical testing data standard curve reference only aaa16124_sc elisa kit alpha synuclein a syn snca nacp alphasyn non a4 component amyloid beta ad 12,345 da precursor syua_mouse 109638747 np_001035916.1 o55042 nm_001042451.2 q3u130 q9cxf8 q9eqc3 q9qur3 neurobiology samples serum plasma cell culture supernatants body fluid tissue homogenate type quantitative competitive 0.1 ng ml competitive0.1
⇄⧉specificity => string (388) "This assay has high sensitivity and excellent specificity for detection of S...
$value[11]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of SNCalpha. No significant cross-reactivity or interference between SNCalpha and analogues was observed. NOTE: Limited by current skills and knowledge, it is impossible for us to complete the cross-reactivity detection between SNCalpha and all the analogues, therefore, cross reaction may still exist in some cases.
⇄purity => string (3) "N/A"
$value[11]['_source']['purity']
⇄form => string (3) "N/A"
$value[11]['_source']['form']
⇄concentration => string (3) "N/A"
$value[11]['_source']['concentration']
⇄storage_stability => string (35) "Store all reagents at 2-8 degree C."
Assay Type||Quantitative Competitive or Sandwich!!Samples||Serum, plasma, cell culture supernatants, body fluid and tissue homogenate!!Sensitivity||1.0 pg/mL
⇄products_name_syn => string (27) "Mouse a Synuclein ELISA Kit"
$value[11]['_source']['products_name_syn']
⇄products_gene_name => string (9) "alpha-SYN"
$value[11]['_source']['products_gene_name']
⇄products_gene_name_syn => string (5) "a-SYN"
$value[11]['_source']['products_gene_name_syn']
⇄⧉products_description => string (1543) "Principle of the Assay: SNCalpha ELISA kit applies the quantitative sandwich...
$value[11]['_source']['products_description']
Principle of the Assay: SNCalpha ELISA kit applies the quantitative sandwich enzyme immunoassay technique. The microtiter plate has been pre-coated with a monoclonal antibody specific for SNCalpha. Standards or samples are then added to the microtiter plate wells and SNCalpha if present, will bind to the antibody pre-coated wells. In order to quantitatively determine the amount of SNCalpha present in the sample, a standardized preparation of horseradish peroxidase (HRP)-conjugated polyclonal antibody, specific for SNCalpha are added to each well to "sandwich" the SNCalpha immobilized on the plate. The microtiter plate undergoes incubation, and then the wells are thoroughly washed to remove all unbound components. Next, substrate solutions are added to each well. The enzyme (HRP) and substrate are allowed to react over a short incubation period. Only those wells that contain SNCalpha and enzyme-conjugated antibody will exhibit a change in color. The enzyme-substrate reaction is terminated by addition of a sulphuric acid solution and the color change is measured spectrophotometrically at a wavelength of 450 nm. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The SNCalpha concentration in each sample is interpolated from this standard curve.<br><br>Intended Uses: This SNCalpha ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Mouse SNCalpha. This ELISA kit for research use only, not for therapeutic or diagnostic applications!
⇄products_references => string (3) "N/A"
$value[11]['_source']['products_references']
⇄⧉products_related_diseases => string (286) "Nervous System Diseases||1126!!Brain Diseases||1106!!Neurodegenerative Disea...
⇄⧉sp_protein_name_syn => string (79) "Non-A beta component of AD amyloid; Non-A4 component of amyloid precursor; N...
$value[11]['_source']['sp_protein_name_syn']
Non-A beta component of AD amyloid; Non-A4 component of amyloid precursor; NACP
⇄sp_gene_name => string (4) "Snca"
$value[11]['_source']['sp_gene_name']
⇄sp_gene_name_syn => string (9) "Syn; NACP"
$value[11]['_source']['sp_gene_name_syn']
⇄sp_entry_name => string (10) "SYUA_MOUSE"
$value[11]['_source']['sp_entry_name']
⇄sp_mim => string (3) "N/A"
$value[11]['_source']['sp_mim']
⇄sp_interactions => string (3) "N/A"
$value[11]['_source']['sp_interactions']
⇄products_url => string (3) "N/A"
$value[11]['_source']['products_url']
⇄products_viewed => string (1) "0"
$value[11]['_source']['products_viewed']
⇄⧉search_terms => string (710) "aaa16236 mouse this assay has high sensitivity and excellent specificity for...
$value[11]['_source']['search_terms']
aaa16236 mouse this assay has high sensitivity and excellent specificity for detection of sncalpha no significant cross reactivity or interference between analogues was observed note limited by current skills knowledge it is impossible us to complete the all therefore reaction may still exist in some cases typical testing data standard curve reference only aaa16236_sc elisa kit alpha synuclein a syn snca nacp alphasyn non a4 component amyloid beta ad 12,345 da precursor syua_mouse 109638747 np_001035916.1 o55042 nm_001042451.2 q3u130 q9cxf8 q9eqc3 q9qur3 neurobiology samples serum plasma cell culture supernatants body fluid tissue homogenate type quantitative competitive sandwich 1.0 pg ml sandwich1.0
⇄⧉specificity => string (388) "This assay has high sensitivity and excellent specificity for detection of S...
$value[12]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of SNCalpha. No significant cross-reactivity or interference between SNCalpha and analogues was observed. NOTE: Limited by current skills and knowledge, it is impossible for us to complete the cross-reactivity detection between SNCalpha and all the analogues, therefore, cross reaction may still exist in some cases.
⇄purity => string (3) "N/A"
$value[12]['_source']['purity']
⇄form => string (3) "N/A"
$value[12]['_source']['form']
⇄concentration => string (3) "N/A"
$value[12]['_source']['concentration']
⇄storage_stability => string (35) "Store all reagents at 2-8 degree C."
⇄products_name_syn => string (28) "Canine a Synuclein ELISA Kit"
$value[12]['_source']['products_name_syn']
⇄products_gene_name => string (9) "alpha-SYN"
$value[12]['_source']['products_gene_name']
⇄products_gene_name_syn => string (5) "a-SYN"
$value[12]['_source']['products_gene_name_syn']
⇄⧉products_description => string (1442) "Principle of the Assay: SNCalpha ELISA kit applies the competitive enzyme im...
$value[12]['_source']['products_description']
Principle of the Assay: SNCalpha ELISA kit applies the competitive enzyme immunoassay technique utilizing a polyclonal anti-SNCalpha antibody and an SNCalpha-HRP conjugate. The assay sample and buffer are incubated together with SNCalpha-HRP conjugate in pre-coated plate for one hour. After the incubation period, the wells are decanted and washed five times. The wells are then incubated with a substrate for HRP enzyme. The product of the enzyme-substrate reaction forms a blue colored complex. Finally, a stop solution is added to stop the reaction, which will then turn the solution yellow. The intensity of color is measured spectrophotometrically at 450nm in a microplate reader. The intensity of the color is inversely proportional to the SNCalpha concentration since SNCalpha from samples and SNCalpha-HRP conjugate compete for the anti-SNCalpha antibody binding site. Since the number of sites is limited, as more sites are occupied by SNCalpha from the sample, fewer sites are left to bind SNCalpha-HRP conjugate. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The SNCalpha concentration in each sample is interpolated from this standard curve.<br><br>Intended Uses: This SNCalpha ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Canine SNCalpha. This ELISA kit for research use only, not for therapeutic or diagnostic applications!
⇄products_references => string (3) "N/A"
$value[12]['_source']['products_references']
⇄⧉products_related_diseases => string (286) "Nervous System Diseases||1126!!Brain Diseases||1106!!Neurodegenerative Disea...
⇄⧉sp_protein_name_syn => string (79) "Non-A beta component of AD amyloid; Non-A4 component of amyloid precursor; N...
$value[12]['_source']['sp_protein_name_syn']
Non-A beta component of AD amyloid; Non-A4 component of amyloid precursor; NACP
⇄sp_gene_name => string (4) "Snca"
$value[12]['_source']['sp_gene_name']
⇄sp_gene_name_syn => string (9) "Syn; NACP"
$value[12]['_source']['sp_gene_name_syn']
⇄sp_entry_name => string (10) "SYUA_MOUSE"
$value[12]['_source']['sp_entry_name']
⇄sp_mim => string (3) "N/A"
$value[12]['_source']['sp_mim']
⇄sp_interactions => string (3) "N/A"
$value[12]['_source']['sp_interactions']
⇄products_url => string (3) "N/A"
$value[12]['_source']['products_url']
⇄products_viewed => string (1) "0"
$value[12]['_source']['products_viewed']
⇄⧉search_terms => string (705) "aaa16913 canine this assay has high sensitivity and excellent specificity fo...
$value[12]['_source']['search_terms']
aaa16913 canine this assay has high sensitivity and excellent specificity for detection of sncalpha no significant cross reactivity or interference between analogues was observed note limited by current skills knowledge it is impossible us to complete the all therefore reaction may still exist in some cases typical testing data standard curve reference only aaa16913_sc elisa kit alpha synuclein a syn snca nacp alphasyn non a4 component amyloid beta ad 12,345 da precursor syua_mouse 109638747 np_001035916.1 o55042 nm_001042451.2 q3u130 q9cxf8 q9eqc3 q9qur3 neurobiology samples serum plasma cell culture supernatants body fluid tissue homogenate type quantitative competitive 1.0 pg ml competitive1.0
⇄concentration => string (32) "1mg/ml (determined by BCA assay)"
$value[13]['_source']['concentration']
⇄⧉storage_stability => string (175) "Can be stored at 4 degree C short term (1-2 weeks).<br>For long term storage...
$value[13]['_source']['storage_stability']
Can be stored at 4 degree C short term (1-2 weeks).<br>For long term storage, aliquot and store at -20 degree C or -70 degree C.<br>Avoid repeated freezing and thawing cycles.
alpha-Synuclein; Snca; Syn; alpha-Synuclein; NACP; Non-A beta component of AD amyloid; Non-A4 component of amyloid precursor
⇄products_gene_name => string (4) "SNCA"
$value[13]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[13]['_source']['products_gene_name_syn']
⇄⧉products_description => string (405) "Alpha-Synuclein, also known as SNCA, an acidic neuronal protein of 140 amino...
$value[13]['_source']['products_description']
Alpha-Synuclein, also known as SNCA, an acidic neuronal protein of 140 amino acids, is extremely heat-resistant and is natively unfolded with an extended structure primarily composed of random coils. alpha-Synuclein has been suggested to be implicated in the pathogenesis of Parkinson. Recombinant mouse alpha-Synuclein, was expressed in E Coli and purified by using conventional chromatography techniques
⇄⧉products_references => string (166) "ueda K., et al. (1993) Proc. Natl. Acad. Sci. uSA 90:11282-11286 ; Kim J., e...
$value[13]['_source']['products_references']
ueda K., et al. (1993) Proc. Natl. Acad. Sci. uSA 90:11282-11286 ; Kim J., et al. (1997) Molecules and Cells 7:78-83 ; Jakes R., et al. (1994) FEBS lett. 345:27-32. ;
⇄⧉products_related_diseases => string (289) "Nervous System Diseases||1501!!Brain Diseases||1479!!Neurodegenerative Disea...
Assay Type||Quantitative Sandwich!!Samples||Serum, plasma, cell culture supernates, Ascites, tissue homogenates or other biological fluids!!Detection Range||0.05-15ng/ml!!Sensitivity||0.018ng/ml
⇄⧉etc_term2 => string (403) "Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Thr...
$value[14]['_source']['etc_term2']
Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Three samples of known concentration were tested on one plate to assess intra-assay precision. Intra-Assay: CV<8%!!Inter-assay Precision||Inter-Assay Precision (Precision between assays) Three samples of known concentration were tested in separate assays to assess inter-assay precision. CV(%) = SD/mean x 100. Inter-Assay: CV<10%
⇄⧉products_description => string (911) "Principle of the Assay: This kit is an Enzyme-Linked Immunosorbent Assay (EL...
$value[14]['_source']['products_description']
Principle of the Assay: This kit is an Enzyme-Linked Immunosorbent Assay (ELISA). The plate has been pre-coated with Human P-SNCA antibody. P-SNCA present in the sample is added and binds to antibodies coated on the wells. And then biotinylated Human P-SNCA Antibody is added and binds to P-SNCA in the sample. Then Streptavidin-HRP is added and binds to the Biotinylated P-SNCA antibody. After incubation unbound Streptavidin-HRP is washed away during a washing step. Substrate solution is then added and color develops in proportion to the amount of Human P-SNCA. The reaction is terminated by addition of acidic stop solution and absorbance is measured at 450 nm.<br><br>Intended Uses: This sandwich kit is for the accurate quantitative detection of Human phosphorylated alpha synuclein (also known as P-SNCA) in serum, plasma, cell culture supernates, Ascites, tissue homogenates or other biological fluids.
⇄⧉search_terms => string (468) "aaa19094 human typical testing data standard curve for reference only aaa190...
$value[14]['_source']['search_terms']
aaa19094 human typical testing data standard curve for reference only aaa19094_sc elisa kit phosphorylated alpha synuclein p snca samples serum plasma cell culture supernates ascites tissue homogenates or other biological fluids assay type quantitative sandwich detection range 0.05 15ng ml sensitivity 0.018ng intra precision within an three of known concentration were tested on one plate to assess cv<8 inter between assays in separate cv = sd mean x 100 cv<10 x100
⇄⧉products_description => string (825) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[15]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Rat Abeta monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄products_references => string (3) "N/A"
$value[15]['_source']['products_references']
⇄⧉products_related_diseases => string (236) "Nervous System Diseases||5223!!Brain Diseases||4978!!Alzheimer Disease||4919...
⇄⧉search_terms => string (659) "aaa13122 rat no cross reaction with other factors typical testing data stand...
$value[15]['_source']['search_terms']
aaa13122 rat no cross reaction with other factors typical testing data standard curve for reference only aaa13122_sc elisa kit amyloid beta peptide abeta ab a4 protein isoform a precursor app aaa ad1 pn2 abpp appi cvap pn ii ctfgamma prea4 protease nexin peptidase 1 40 42 alzheimer disease cerebral vascular 84,521 da s alpha aicd 59 aid 57 50 a4_human 4502167 np_000475.1 p05067 nm_000484.3 p09000 p78438 q13764 q13778 q13793 q16011 b2r5v1 b4dii8 d3dsd1 d3dsd2 d3dsd3 gene 605714 samples serum plasma or cell culture supernatant assay type quantitative sandwich detection range 1000 pg ml 15.6 sensitivity up to 5 intra precision peptidase1 aicd59 aid57 to5
⇄⧉products_description => string (831) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[16]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Mouse Abeta1-42 monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄products_references => string (3) "N/A"
$value[16]['_source']['products_references']
⇄⧉products_related_diseases => string (236) "Nervous System Diseases||5224!!Brain Diseases||4979!!Alzheimer Disease||4922...
⇄⧉products_description => string (678) "Principle of the Assay: This experiment use double-sandwich elisa technique ...
$value[17]['_source']['products_description']
Principle of the Assay: This experiment use double-sandwich elisa technique and the ELISA Kit provided is typical. The pre-coated antibody is Rat Abeta1-42 monoclonal antibody and the detecting antibody is polyclonal antibody with biotin labeled. Samples and biotin labeling antibody are added into ELISA plate wells and washed out with PBS or TBS. Then Avidin-peroxidase conjugates are added to ELISA wells in order; Use TMB substrate for coloring after reactant thoroughly washed out by PBS or TBS. TMB turns into blue in peroxidase catalytic and finally turns into yellow under the action of acid. The color depth and the testing factors in samples are positively correlated.
⇄products_references => string (3) "N/A"
$value[17]['_source']['products_references']
⇄⧉products_related_diseases => string (236) "Nervous System Diseases||5223!!Brain Diseases||4978!!Alzheimer Disease||4919...
⇄⧉search_terms => string (649) "aaa12964 rat no cross reaction with other factors typical testing data stand...
$value[17]['_source']['search_terms']
aaa12964 rat no cross reaction with other factors typical testing data standard curve for reference only aaa12964_sc elisa kit amyloid beta peptide 1 42 abeta1 ab1 a4 protein precursor app aaa ad1 pn2 abpp appi cvap abeta pn ii ctfgamma prea4 protease nexin peptidase 40 alzheimer disease cerebral vascular 84,521 da s alpha aicd 59 aid 57 50 a4_human 112927 p05067.3 p05067 p09000 p78438 q13764 q13778 q13793 q16011 b2r5v1 b4dii8 d3dsd1 d3dsd2 d3dsd3 gene 605714 samples serum plasma or cell culture supernatant assay type quantitative sandwich detection range 1000 pg ml 15.6 sensitivity up to 5pg intra precision peptide1 peptidase40 aicd59 aid57
⇄⧉specificity => string (175) "This assay has high sensitivity and excellent specificity for detection of r...
$value[18]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of rat APP. No significant cross-reactivity or interference between rat APP and analogues was observed.
⇄purity => string (3) "N/A"
$value[18]['_source']['purity']
⇄form => string (3) "N/A"
$value[18]['_source']['form']
⇄concentration => string (3) "N/A"
$value[18]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[18]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
Samples||Serum, plasma, tissue homogenates.!!Assay Type||Sandwich!!Detection Range||15.6 ng/ml-1000 ng/ml.!!Sensitivity||Typically less than 3.9 ng/ml
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[18]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄⧉products_description => string (727) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[18]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for APP has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any APP present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for APP is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of APP bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄⧉sp_protein_name_syn => string (185) "ABPP; APP; Alzheimer disease amyloid A4 protein homologCleaved into the foll...
$value[18]['_source']['sp_protein_name_syn']
ABPP; APP; Alzheimer disease amyloid A4 protein homologCleaved into the following 6 chains:Soluble APP-beta; S-APP-beta; CTF-alpha; Beta-amyloid protein 42Alternative name(s):Beta-APP42
⇄⧉search_terms => string (785) "aaa18393 rat this assay has high sensitivity and excellent specificity for d...
$value[18]['_source']['search_terms']
aaa18393 rat this assay has high sensitivity and excellent specificity for detection of app no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa18393_td elisa kit amyloid beta a4 precursor protein aaa abeta abpp ad1 appi ctfgamma cvap pn2 otthump00000096096 peptide cerebral vascular peptidase nexin ii protease 6,300 da alzheimer disease homologcleaved into the following 6 chains:soluble s ctf alpha 42alternative name app42 a4_rabit 2492500 q28748.1 q28748 samples serum plasma tissue homogenates type sandwich range 15.6 ng ml 1000 typically less than 3.9 intra precision within an cv <8 three known concentration were tested twenty times on one plate to assess inter assays <10 in following6 than3.9
⇄⧉specificity => string (385) "This assay has high sensitivity and excellent specificity for detection of A...
$value[19]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of AbetaA4. No significant cross-reactivity or interference between AbetaA4 and analogues was observed. NOTE: Limited by current skills and knowledge, it is impossible for us to complete the cross-reactivity detection between AbetaA4 and all the analogues, therefore, cross reaction may still exist in some cases.
⇄purity => string (3) "N/A"
$value[19]['_source']['purity']
⇄form => string (3) "N/A"
$value[19]['_source']['form']
⇄concentration => string (3) "N/A"
$value[19]['_source']['concentration']
⇄storage_stability => string (35) "Store all reagents at 2-8 degree C."
⇄⧉products_description => string (1429) "Principle of the Assay: AbetaA4 ELISA kit applies the competitive enzyme imm...
$value[19]['_source']['products_description']
Principle of the Assay: AbetaA4 ELISA kit applies the competitive enzyme immunoassay technique utilizing a monoclonal anti-AbetaA4 antibody and an AbetaA4-HRP conjugate. The assay sample and buffer are incubated together with AbetaA4-HRP conjugate in pre-coated plate for one hour. After the incubation period, the wells are decanted and washed five times. The wells are then incubated with a substrate for HRP enzyme. The product of the enzyme-substrate reaction forms a blue colored complex. Finally, a stop solution is added to stop the reaction, which will then turn the solution yellow. The intensity of color is measured spectrophotometrically at 450nm in a microplate reader. The intensity of the color is inversely proportional to the AbetaA4 concentration since AbetaA4 from samples and AbetaA4-HRP conjugate compete for the anti-AbetaA4 antibody binding site. Since the number of sites is limited, as more sites are occupied by AbetaA4 from the sample, fewer sites are left to bind AbetaA4-HRP conjugate. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The AbetaA4 concentration in each sample is interpolated from this standard curve.<br><br>Intended Uses: This AbetaA4 ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Monkey AbetaA4. This ELISA kit for research use only, not for therapeutic or diagnostic applications!
⇄products_references => string (3) "N/A"
$value[19]['_source']['products_references']
⇄⧉products_related_diseases => string (236) "Nervous System Diseases||5210!!Brain Diseases||4967!!Alzheimer Disease||4913...
