IHC (Immunohiostchemistry)
(MARCO Antibody-Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE))
Rabbit MARCO Polyclonal Antibody | anti-MARCO antibody
MARCO Rabbit anti-Human Polyclonal Antibody
Gene Names
MARCO; SR-A6; SCARA2
Reactivity
Mouse, Rat, Human
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry
Purity
Affinity purified
Synonyms
MARCO, Antibody; MARCO Rabbit anti-Human Polyclonal Antibody; IHC-plus MARCO Antibody; MARCO; Macrophage receptor MARCO; Macrophage receptors marco; SCARA2; anti-MARCO antibody
Host
Rabbit
Reactivity
Mouse, Rat, Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purified
Form/Format
PBS, pH7.3, 0.02% Sodium Azide, 50% Glycerol
Concentration
2.29mg/ml (varies by lot)
Applicable Applications for anti-MARCO antibody
WB (Western Blot), IHC (Immunohistochemistry), IHC (Immunohistochemistry)
Target
Human MARCO
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 421-520 of human MARCO (NP_006761.1). SVSVRIVGSSNRGRAEVYYSGTWGTICDDEWQNSDAIVFCRMLGYSKGRALYKVGAGTGQIWLDNVQCRGTESTLWSCTKNSWGHHDCSHEEDAGVECSV
Conjugation
Unconjugated
Preparation and Storage
Store at -20 degree C. Avoid freeze-thaw cycles.
IHC (Immunohiostchemistry)
(MARCO Antibody-Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE))
IHC (Immunohiostchemistry)
(MARCO Antibody-Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE))
WB (Western Blot)
(MARCO Antibody-Western blot analysis of extracts of various cell lines, using MARCO antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.)
WB (Western Blot)
(MARCO Antibody-Western blot analysis of extracts of various cell lines, using MARCO antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.)
Related Product Information for anti-MARCO antibody
MARCO antibody is an unconjugated rabbit polyclonal antibody to MARCO from human. It is reactive with human, mouse and rat. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
43,865 Da
NCBI Official Full Name
macrophage receptor MARCO
NCBI Official Synonym Full Names
macrophage receptor with collagenous structure
NCBI Official Symbol
MARCO
NCBI Official Synonym Symbols
SR-A6; SCARA2
NCBI Protein Information
macrophage receptor MARCO
UniProt Protein Name
Macrophage receptor MARCO
UniProt Gene Name
MARCO
UniProt Synonym Gene Names
SCARA2
Similar Products
Product Notes
The MARCO marco (Catalog #AAA162872) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MARCO Rabbit anti-Human Polyclonal Antibody reacts with Mouse, Rat, Human and may cross-react with other species as described in the data sheet. AAA Biotech's MARCO can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the MARCO marco for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MARCO, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.