Highly validated and characterized monoclonal/polyclonal
antibodies and recombinant
proteins
The majority of AAA Biotech’s antibodies are highly validated and can be use in multiple
applications such as ELISA, FC,
ICC, IF, IHC, IP, WB, etc. We have antibodies available for rare species, in multiple conjugated
forms or recombinant
antibodies.
As for our high quality proteins, the majority have 90% purity, detected by SDS-PAGE while some are
available in
different tags such as Flag, GST, His, MBP, etc. We also carry high quality native and biologically
active proteins.
AAA Biotech is constantly working to expand our capacity to provide recombinant proteins and
antibodies to most
target proteins.
SELECT `p`.*, `pd`.*, IFNULL(pdns.ncbi_summary, "N/A") as ncbi_summary_pdns, IFNULL(pdns.sp_comments, "N/A") as sp_comments_pdns, IFNULL(pdns.ncbi_research_articles, "N/A") as ncbi_research_articles_pdns, IFNULL(pe.products_description_extra, "N/A") as products_description_extra
FROM (`products`, `products` as `p`)
LEFT OUTER JOIN `products_description` as `pd` ON `p`.`products_id` = `pd`.`products_id`
LEFT OUTER JOIN `products_description_ncbi_sp` as `pdns` ON `p`.`products_id` = `pdns`.`products_id`
LEFT OUTER JOIN `products_extra` as `pe` ON `p`.`products_id` = `pe`.`products_id`
WHERE `p`.`products_id` = '24863'
AND `pd`.`language_id` = 1
LIMIT 1
Query
Database
2.17 ms
select p.*, pd.*,
ifnull(pdns.ncbi_summary, 'N/A') as ncbi_summary_pdns,
ifnull(pdns.sp_comments, 'N/A') as sp_comments_pdns,
ifnull(pdns.ncbi_research_articles, 'N/A') as ncbi_research_articles_pdns,
ifnull(pe.products_description_extra, 'N/A') as products_description_extra
from products p
LEFT OUTER JOIN products_description pd on p.products_id = pd.products_id
LEFT OUTER JOIN products_description_ncbi_sp pdns on p.products_id = pdns.products_id
LEFT OUTER JOIN products_extra pe on p.products_id = pe.products_id
where p.products_id = '24863' and pd.language_id = 1
Query
Database
1.40 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '24863'
Database (4 total Queries, 4 of them unique across 2 Connections)
Time
Query String
2.15 ms
SELECT `p`.*, `pd`.*, IFNULL(pdns.ncbi_summary, "N/A") as ncbi_summary_pdns, IFNULL(pdns.sp_comments, "N/A") as sp_comments_pdns, IFNULL(pdns.ncbi_research_articles, "N/A") as ncbi_research_articles_pdns, IFNULL(pe.products_description_extra, "N/A") as products_description_extra
FROM (`products`, `products` as `p`)
LEFT OUTER JOIN `products_description` as `pd` ON `p`.`products_id` = `pd`.`products_id`
LEFT OUTER JOIN `products_description_ncbi_sp` as `pdns` ON `p`.`products_id` = `pdns`.`products_id`
LEFT OUTER JOIN `products_extra` as `pe` ON `p`.`products_id` = `pe`.`products_id`
WHERE `p`.`products_id` = '24863'
AND `pd`.`language_id` = 1
LIMIT 1
select p.*, pd.*,
ifnull(pdns.ncbi_summary, 'N/A') as ncbi_summary_pdns,
ifnull(pdns.sp_comments, 'N/A') as sp_comments_pdns,
ifnull(pdns.ncbi_research_articles, 'N/A') as ncbi_research_articles_pdns,
ifnull(pe.products_description_extra, 'N/A') as products_description_extra
from products p
LEFT OUTER JOIN products_description pd on p.products_id = pd.products_id
LEFT OUTER JOIN products_description_ncbi_sp pdns on p.products_id = pdns.products_id
LEFT OUTER JOIN products_extra pe on p.products_id = pe.products_id
where p.products_id = '24863' and pd.language_id = 1
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '24863'
⇄specificity => string (63) "Recognizes human MEOX2. Species Crossreactivity: mouse and rat."
$value['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value['purity']
⇄⧉form => string (80) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Bio...
$value['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
⇄concentration => string (3) "N/A"
$value['concentration']
⇄⧉storage_stability => string (439) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
⇄app_notes => string (63) "IF: 10ug/ml<br>Applications are based on unconjugated antibody."
$value['app_notes']
⇄⧉testing_protocols => string (882) "Application Data||Detection limit for recombinant GST tagged MEOX2 is ~0.3ng...
$value['testing_protocols']
Application Data||Detection limit for recombinant GST tagged MEOX2 is ~0.3ng/ml as a capture antibody.||AAA24863_APP7.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to MEOX2 on HeLa cell. [antibody concentration 10ug/ml]||AAA24863_IF6.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to MEOX2 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 1ug/ml]||AAA24863_IHC5.jpg!!WB (Western Blot)||MEOX2 monoclonal antibody. Western Blot analysis of MEOX2 expression in Hela NE.||AAA24863_WB4.jpg!!WB (Western Blot)||MEOX2 monoclonal antibody. Western Blot analysis of MEOX2 expression in PC-12.||AAA24863_WB3.jpg!!WB (Western Blot)||MEOX2 monoclonal antibody Western Blot analysis of MEOX2 expression in HeLa.||AAA24863_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (59.07kD).||AAA24863_WB.jpg
⇄⧉etc_term1 => string (478) "Immunogen||Full length recombinant corresponding to aa1-303 from human MEOX2...
$value['etc_term1']
Immunogen||Full length recombinant corresponding to aa1-303 from human MEOX2 (AAH17021) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||MEHPLFGCLRSPHATAQGLHPFSQSSLALHGRSDHMSYPELSTSSSSCIIAGYPNEEGMFASQHHRGHHHHHHHHHHHHQQQQHQALQTNWHLPQMSSPPSAARHSLCLQPDSGGPPELGSSPPVLCSNSSSLGSSTPTGAACAPGDYGRQALSPAEAEKRSGGKRKSDSSDSQEGNYKSEVNSKPRKERTAFTKEQIRELEAEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRMKWKRVKGGQQGAAAREKELVNVKKGTLLPSELSGIGAATLQQTGDSIANEDSHDSDHSSEHAHL!!Conjugate||Biotin
⇄specificity => string (63) "Recognizes human MEOX2. Species Crossreactivity: mouse and rat."
$value->a['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value->a['purity']
⇄⧉form => string (80) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Bio...
$value->a['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
⇄concentration => string (3) "N/A"
$value->a['concentration']
⇄⧉storage_stability => string (439) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value->a['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
⇄app_notes => string (63) "IF: 10ug/ml<br>Applications are based on unconjugated antibody."
$value->a['app_notes']
⇄⧉testing_protocols => string (882) "Application Data||Detection limit for recombinant GST tagged MEOX2 is ~0.3ng...
$value->a['testing_protocols']
Application Data||Detection limit for recombinant GST tagged MEOX2 is ~0.3ng/ml as a capture antibody.||AAA24863_APP7.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to MEOX2 on HeLa cell. [antibody concentration 10ug/ml]||AAA24863_IF6.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to MEOX2 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 1ug/ml]||AAA24863_IHC5.jpg!!WB (Western Blot)||MEOX2 monoclonal antibody. Western Blot analysis of MEOX2 expression in Hela NE.||AAA24863_WB4.jpg!!WB (Western Blot)||MEOX2 monoclonal antibody. Western Blot analysis of MEOX2 expression in PC-12.||AAA24863_WB3.jpg!!WB (Western Blot)||MEOX2 monoclonal antibody Western Blot analysis of MEOX2 expression in HeLa.||AAA24863_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (59.07kD).||AAA24863_WB.jpg
⇄⧉etc_term1 => string (478) "Immunogen||Full length recombinant corresponding to aa1-303 from human MEOX2...
$value->a['etc_term1']
Immunogen||Full length recombinant corresponding to aa1-303 from human MEOX2 (AAH17021) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||MEHPLFGCLRSPHATAQGLHPFSQSSLALHGRSDHMSYPELSTSSSSCIIAGYPNEEGMFASQHHRGHHHHHHHHHHHHQQQQHQALQTNWHLPQMSSPPSAARHSLCLQPDSGGPPELGSSPPVLCSNSSSLGSSTPTGAACAPGDYGRQALSPAEAEKRSGGKRKSDSSDSQEGNYKSEVNSKPRKERTAFTKEQIRELEAEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRMKWKRVKGGQQGAAAREKELVNVKKGTLLPSELSGIGAATLQQTGDSIANEDSHDSDHSSEHAHL!!Conjugate||Biotin
⇄specificity => string (63) "Recognizes human MEOX2. Species Crossreactivity: mouse and rat."
$value->d['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value->d['purity']
⇄⧉form => string (80) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Bio...
$value->d['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
⇄concentration => string (3) "N/A"
$value->d['concentration']
⇄⧉storage_stability => string (439) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value->d['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
⇄app_notes => string (63) "IF: 10ug/ml<br>Applications are based on unconjugated antibody."
$value->d['app_notes']
⇄⧉testing_protocols => string (882) "Application Data||Detection limit for recombinant GST tagged MEOX2 is ~0.3ng...
$value->d['testing_protocols']
Application Data||Detection limit for recombinant GST tagged MEOX2 is ~0.3ng/ml as a capture antibody.||AAA24863_APP7.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to MEOX2 on HeLa cell. [antibody concentration 10ug/ml]||AAA24863_IF6.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to MEOX2 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 1ug/ml]||AAA24863_IHC5.jpg!!WB (Western Blot)||MEOX2 monoclonal antibody. Western Blot analysis of MEOX2 expression in Hela NE.||AAA24863_WB4.jpg!!WB (Western Blot)||MEOX2 monoclonal antibody. Western Blot analysis of MEOX2 expression in PC-12.||AAA24863_WB3.jpg!!WB (Western Blot)||MEOX2 monoclonal antibody Western Blot analysis of MEOX2 expression in HeLa.||AAA24863_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (59.07kD).||AAA24863_WB.jpg
⇄⧉etc_term1 => string (478) "Immunogen||Full length recombinant corresponding to aa1-303 from human MEOX2...
$value->d['etc_term1']
Immunogen||Full length recombinant corresponding to aa1-303 from human MEOX2 (AAH17021) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||MEHPLFGCLRSPHATAQGLHPFSQSSLALHGRSDHMSYPELSTSSSSCIIAGYPNEEGMFASQHHRGHHHHHHHHHHHHQQQQHQALQTNWHLPQMSSPPSAARHSLCLQPDSGGPPELGSSPPVLCSNSSSLGSSTPTGAACAPGDYGRQALSPAEAEKRSGGKRKSDSSDSQEGNYKSEVNSKPRKERTAFTKEQIRELEAEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRMKWKRVKGGQQGAAAREKELVNVKKGTLLPSELSGIGAATLQQTGDSIANEDSHDSDHSSEHAHL!!Conjugate||Biotin
⇄⧉products_description => string (1465) "Intended Uses: This ApoC2 ELISA kit is a 1.5 hour solid-phase ELISA designed...
$value[0]['_source']['products_description']
Intended Uses: This ApoC2 ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Mouse ApoC2. This ELISA kit for research use only!<br><br>Principle of the Assay: ApoC2 ELISA kit applies the quantitative sandwich enzyme immunoassay technique. The microtiter plate has been pre-coated with a monoclonal antibody specific for ApoC2. Standards or samples are then added to the microtiter plate wells and ApoC2 if present, will bind to the antibody pre-coated wells. In order to quantitatively determine the amount of ApoC2 present in the sample, a standardized preparation of horseradish peroxidase (HRP)-conjugated polyclonal antibody, specific for ApoC2 are added to each well to "sandwich" the ApoC2 immobilized on the plate. The microtiter plate undergoes incubation, and then the wells are thoroughly washed to remove all unbound components. Next, substrate solutions are added to each well. The enzyme (HRP) and substrate are allowed to react over a short incubation period. Only those wells that contain ApoC2 and enzyme-conjugated antibody will exhibit a change in color. The enzyme-substrate reaction is terminated by addition of a sulphuric acid solution and the color change is measured spectrophotometrically at a wavelength of 450 nm. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The ApoC2 concentration in each sample is interpolated from this standard curve.
⇄⧉ncbi_pathways => string (458) "Chylomicron-mediated Lipid Transport Pathway||106157!!Disease Pathway||53076...
$value[0]['_source']['ncbi_pathways']
Chylomicron-mediated Lipid Transport Pathway||106157!!Disease Pathway||530764!!Diseases Associated With Visual Transduction Pathway||771581!!HDL-mediated Lipid Transport Pathway||106158!!Lipid Digestion, Mobilization, And Transport Pathway||106111!!Lipoprotein Metabolism Pathway||106156!!Metabolism Pathway||477135!!Metabolism Of Lipids And Lipoproteins Pathway||160976!!Retinoid Metabolism And Transport Pathway||187208!!Signal Transduction Pathway||477114
⇄⧉search_terms => string (400) "aaa16085 mouse typical testing data standard curve for reference only aaa160...
$value[0]['_source']['search_terms']
aaa16085 mouse typical testing data standard curve for reference only aaa16085_td elisa kit apolipoprotein c2 apoc2 c ii apo cii apoc 11,284 da apc2 apoc2_human 32130518 np_000474.2 p02655 nm_000483.4 q9bs39 q9ude3 q9unk3 c0jyy4 608083 cardiovascular samples serum plasma cell culture supernatants body fluid and tissue homogenate assay type quantitative sandwich sensitivity 0.1 ug ml sensitivity0.1
⇄⧉products_description => string (1465) "Intended Uses: This ApoC3 ELISA kit is a 1.5 hour solid-phase ELISA designed...
$value[1]['_source']['products_description']
Intended Uses: This ApoC3 ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Mouse ApoC3. This ELISA kit for research use only!<br><br>Principle of the Assay: ApoC3 ELISA kit applies the quantitative sandwich enzyme immunoassay technique. The microtiter plate has been pre-coated with a monoclonal antibody specific for ApoC3. Standards or samples are then added to the microtiter plate wells and ApoC3 if present, will bind to the antibody pre-coated wells. In order to quantitatively determine the amount of ApoC3 present in the sample, a standardized preparation of horseradish peroxidase (HRP)-conjugated polyclonal antibody, specific for ApoC3 are added to each well to "sandwich" the ApoC3 immobilized on the plate. The microtiter plate undergoes incubation, and then the wells are thoroughly washed to remove all unbound components. Next, substrate solutions are added to each well. The enzyme (HRP) and substrate are allowed to react over a short incubation period. Only those wells that contain ApoC3 and enzyme-conjugated antibody will exhibit a change in color. The enzyme-substrate reaction is terminated by addition of a sulphuric acid solution and the color change is measured spectrophotometrically at a wavelength of 450 nm. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The ApoC3 concentration in each sample is interpolated from this standard curve.
⇄⧉ncbi_pathways => string (430) "Chylomicron-mediated Lipid Transport Pathway||106157!!Disease Pathway||53076...
$value[1]['_source']['ncbi_pathways']
Chylomicron-mediated Lipid Transport Pathway||106157!!Disease Pathway||530764!!Diseases Associated With Visual Transduction Pathway||771581!!HDL-mediated Lipid Transport Pathway||106158!!Lipid Digestion, Mobilization, And Transport Pathway||106111!!Lipoprotein Metabolism Pathway||106156!!Metabolism Pathway||477135!!Metabolism Of Lipids And Lipoproteins Pathway||160976!!PPAR Signaling Pathway||83042!!PPAR Signaling Pathway||450
⇄⧉search_terms => string (411) "aaa16543 mouse typical testing data standard curve for reference only aaa165...
$value[1]['_source']['search_terms']
aaa16543 mouse typical testing data standard curve for reference only aaa16543_sc elisa kit apolipoprotein c3 apoc3 c iii halp2 apociii apo ciii apoc 10,852 da apoc3_human 4557323 np_000031.1 p02656 nm_000040.1 q08e83 q6q786 gene 614028 cardiovascular samples serum plasma cell culture supernatants body fluid and tissue homogenate assay type competitive detection range 100 2500ng ml sensitivity 1.0ng range100
⇄⧉specificity => string (183) "This assay has high sensitivity and excellent specificity for detection of m...
$value[2]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of mouse APOC2. No significant cross-reactivity or interference between mouse APOC2 and analogues was observed.
⇄purity => string (3) "N/A"
$value[2]['_source']['purity']
⇄form => string (3) "N/A"
$value[2]['_source']['form']
⇄concentration => string (3) "N/A"
$value[2]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[2]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[2]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄⧉products_description => string (625) "Principle of the Assay: This assay employs the competitive inhibition enzyme...
$value[2]['_source']['products_description']
Principle of the Assay: This assay employs the competitive inhibition enzyme immunoassay technique. The microtiter plate provided in this kit has been pre-coated with APOC2. Standards or samples are added to the appropriate microtiter plate wells with Horseradish Peroxidase (HRP) conjugated antibody preparation specific for APOC2. The competitive inhibition reaction is launched between with pre-coated APOC2 and APOC2 in samples. A substrate solution is added to the wells and the color develops in opposite to the amount of APOC2 in the sample. The color development is stopped and the intensity of the color is measured.
⇄⧉ncbi_pathways => string (307) "Chylomicron-mediated Lipid Transport Pathway||574759!!HDL-mediated Lipid Tra...
$value[2]['_source']['ncbi_pathways']
Chylomicron-mediated Lipid Transport Pathway||574759!!HDL-mediated Lipid Transport Pathway||574760!!Lipid Digestion, Mobilization, And Transport Pathway||574755!!Lipoprotein Metabolism Pathway||574758!!Metabolism Pathway||574739!!Metabolism Of Lipids And Lipoproteins Pathway||574754!!Statin Pathway||198363
⇄⧉search_terms => string (590) "aaa18200 mouse this assay has high sensitivity and excellent specificity for...
$value[2]['_source']['search_terms']
aaa18200 mouse this assay has high sensitivity and excellent specificity for detection of apoc2 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa18200_td elisa kit apolipoprotein c ii mgc75082 apo cii apoc c2 10,741 da apoc2_mouse 485050543 np_001264873.1 q05020 nm_001277944.1 samples serum plasma tissue homogenates type quantitative competitive range 18.8 ng ml 1200 < 9.4 intra precision within an cv <8 three known concentration were tested twenty times on one plate to assess inter assays <10 in <9.4
⇄⧉specificity => string (183) "This assay has high sensitivity and excellent specificity for detection of m...
$value[3]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of mouse APOC3. No significant cross-reactivity or interference between mouse APOC3 and analogues was observed.
⇄purity => string (3) "N/A"
$value[3]['_source']['purity']
⇄form => string (3) "N/A"
$value[3]['_source']['form']
⇄concentration => string (3) "N/A"
$value[3]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[3]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[3]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄⧉products_description => string (625) "Principle of the Assay: This assay employs the competitive inhibition enzyme...
$value[3]['_source']['products_description']
Principle of the Assay: This assay employs the competitive inhibition enzyme immunoassay technique. The microtiter plate provided in this kit has been pre-coated with APOC3. Standards or samples are added to the appropriate microtiter plate wells with Horseradish Peroxidase (HRP) conjugated antibody preparation specific for APOC3. The competitive inhibition reaction is launched between with pre-coated APOC3 and APOC3 in samples. A substrate solution is added to the wells and the color develops in opposite to the amount of APOC3 in the sample. The color development is stopped and the intensity of the color is measured.
⇄⧉search_terms => string (625) "aaa18374 mouse this assay has high sensitivity and excellent specificity for...
$value[3]['_source']['search_terms']
aaa18374 mouse this assay has high sensitivity and excellent specificity for detection of apoc3 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa18374_td elisa kit apolipoprotein c iii apociii mgc150353 isoform b apo ciii apoc c3 10,982 da apoc3_mouse 577019554 np_001276685.1 p33622 nm_001289756.1 q8vc58 q9cpp9 samples serum plasma tissue homogenates type quantitative competitive range 18.75 ng ml 1200 < 9.375ng intra precision within an cv <8 three known concentration were tested twenty times on one plate to assess inter assays <10 in
⇄⧉etc_term1 => string (173) "Samples||Serum, plasma, Cell Culture Supernatants, body fluid and tissue hom...
$value[4]['_source']['etc_term1']
Samples||Serum, plasma, Cell Culture Supernatants, body fluid and tissue homogenate!!Assay Type||Competitive or Sandwich!!Detection Range||10-250ng/mL!!Sensitivity||1.0ng/mL
⇄⧉products_description => string (1427) "Intended Uses: This ApoA4 ELISA kit is a 1.5 hour solid-phase ELISA designed...
$value[4]['_source']['products_description']
Intended Uses: This ApoA4 ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Human ApoA4.<br><br>Principle of the Assay: ApoA4 ELISA kit applies the quantitative sandwich enzyme immunoassay technique. The microtiter plate has been pre-coated with a monoclonal antibody specific for ApoA4. Standards or samples are then added to the microtiter plate wells and ApoA4 if present, will bind to the antibody pre-coated wells. In order to quantitatively determine the amount of ApoA4 present in the sample, a standardized preparation of horseradish peroxidase (HRP)-conjugated polyclonal antibody, specific for ApoA4 are added to each well to "sandwich" the ApoA4 immobilized on the plate. The microtiter plate undergoes incubation, and then the wells are thoroughly washed to remove all unbound components. Next, substrate solutions are added to each well. The enzyme (HRP) and substrate are allowed to react over a short incubation period. Only those wells that contain ApoA4 and enzyme-conjugated antibody will exhibit a change in color. The enzyme-substrate reaction is terminated by addition of a sulphuric acid solution and the color change is measured spectrophotometrically at a wavelength of 450 nm. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The ApoA4 concentration in each sample is interpolated from this standard curve.
⇄⧉ncbi_pathways => string (442) "Amyloids Pathway||366238!!Chylomicron-mediated Lipid Transport Pathway||1061...
$value[4]['_source']['ncbi_pathways']
Amyloids Pathway||366238!!Chylomicron-mediated Lipid Transport Pathway||106157!!Disease Pathway||530764!!Diseases Associated With Visual Transduction Pathway||771581!!Fat Digestion And Absorption Pathway||194385!!Fat Digestion And Absorption Pathway||194324!!Lipid Digestion, Mobilization, And Transport Pathway||106111!!Lipoprotein Metabolism Pathway||106156!!Metabolism Pathway||477135!!Metabolism Of Lipids And Lipoproteins Pathway||160976
⇄⧉search_terms => string (407) "aaa16220 human typical testing data standard curve for reference only aaa162...
$value[4]['_source']['search_terms']
aaa16220 human typical testing data standard curve for reference only aaa16220_td elisa kit apolipoprotein a4 apoa4 a iv apo aiv apoa 45,399 da apoa4_human 71773110 np_000473.2 p06727 nm_000482.3 q14cw8 q6q787 a8msl6 107690 cardiovascular samples serum plasma cell culture supernatants body fluid and tissue homogenate assay type competitive or sandwich detection range 10 250ng ml sensitivity 1.0ng range10
<b>Storage:</b><br>Avoid repeated freeze/thaw cycles.<br>Store at 2-8 degree C for one month. <br>Aliquot and store at -80 degree C for 12 months.<br><br><b>Stability Test:</b><br>The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 degree C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
⇄app_tested => string (56) "Positive Control; Immunogen; SDS-PAGE; Western Blot (WB)"
$value[5]['_source']['app_tested']
⇄app_notes => string (75) "(May be suitable for use in other assays to be determined by the end user.)"
Traits||Freeze-dried powder!!Predicted isoelectric point||6.0!!Usage||Reconstitute in 10mM PBS (pH7.4) to a concentration of 0.1-1.0 mg/mL. Do not vortex.
⇄⧉search_terms => string (818) "aaa20227 e coli mus musculus mouse > 95 20mm tris 150mm nacl ph8.0 containin...
$value[5]['_source']['search_terms']
aaa20227 e coli mus musculus mouse > 95 20mm tris 150mm nacl ph8.0 containing 1mm edta dtt 0.01 sarcosyl 5 trehalose and proclin300 sds page wb elisa ip coip purification amine reactive labeling may be suitable for use in other assays to determined by the end user
sequence information aaa20227_seq aaa20227_sds3 testing data aaa20227_td2 recombinant protein apolipoprotein c2 apoc2 c ii apo cii apoc apoc2_mouse 485050543 np_001264873.1 q05020 nm_001277944.1 source prokaryotic expression residues ile13~glu97 tags two n terminal his tag gst tissue specificity plasma subcellular location secreted traits freeze dried powder
predicted isoelectric point 6.0 molecular mass 39.4kda accurate 39kda as reducing conditions usage reconstitute a concentration of 0.1 1.0 mg ml do not vortex >95 sarcosyl5 point6.0 of0.1
⇄⧉products_description => string (1257) "Principle of the Assay: The principle of the double antibody sandwich ELISA ...
$value[6]['_source']['products_description']
Principle of the Assay: The principle of the double antibody sandwich ELISA is represented in Figure 1. In this assay the apolipoprotein A1 (Apo-A1) present in samples reacts with the anti-Apo-A1 antibodies, which have been adsorbed to the surface of polystyrene microtitre wells. After the removal of unbound proteins by washing, anti-Apo-A1 antibodies conjugated with horseradish peroxidase (HRP) are added. These enzyme-labeled antibodies form complexes with the previously bound Apo-A1. Following another washing step, the enzyme bound to the immunosorbent is assayed by the addition of a chromogenic substrate, 3,3',5,5'-tetramethylbenzidine (TMB). The quantity of bound enzyme varies directly with the concentration of Apo-A1 in the sample tested; thus, the absorbance, at 450 nm, is a measure of the concentration of Apo-A1 in the test sample. The quantity of Apo-A1 in the test sample can be interpolated from the standard curve constructed from the standards, and corrected for sample dilution.<br><br>Intended Uses: The Apo-A1 test kit is a highly sensitive two-site enzyme linked immunoassay (ELISA) for measuring Apo-A1 in human biological samples. If the ELISA is to be used outside the intended use, the user may need to optimize for said use.
⇄⧉search_terms => string (249) "aaa14474 human elisa kit apolipoprotein a1 a 1 i apoa1 mgc117399 apo ai apoa...
$value[6]['_source']['search_terms']
aaa14474 human elisa kit apolipoprotein a1 a 1 i apoa1 mgc117399 apo ai apoa otthump00000043268 otthump00000069346 otthump00000069347 otthump00000069348 7,433 da q9y355_human 4960066 p02647 q6lej8 q8tdb0 q9y355 samples biological assay type sandwich
<b>Storage:</b><br>Avoid repeated freeze/thaw cycles.<br>Store at 4 degree C for frequent use.<br>Aliquot and store at -20 degree C for 24 months.<br><br><b>Stability Test:</b><br>thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 degree C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
Western blotting: 0.5-3ug/mL<br>Immunohistochemistry: 5-30ug/mL<br>Immunocytochemistry: 5-30ug/mL<br>Optimal working dilutions must be determined by end user.
⇄⧉testing_protocols => string (570) "IHC (Immunohistochemistry)||DAB staining on IHC-P;<br>Samples: Human Small i...
⇄⧉ncbi_pathways => string (442) "Amyloids Pathway||366238!!Chylomicron-mediated Lipid Transport Pathway||1061...
$value[7]['_source']['ncbi_pathways']
Amyloids Pathway||366238!!Chylomicron-mediated Lipid Transport Pathway||106157!!Disease Pathway||530764!!Diseases Associated With Visual Transduction Pathway||771581!!Fat Digestion And Absorption Pathway||194385!!Fat Digestion And Absorption Pathway||194324!!Lipid Digestion, Mobilization, And Transport Pathway||106111!!Lipoprotein Metabolism Pathway||106156!!Metabolism Pathway||477135!!Metabolism Of Lipids And Lipoproteins Pathway||160976
⇄⧉search_terms => string (767) "aaa20915 rabbit human antigen specific affinity chromatography followed by p...
$value[7]['_source']['search_terms']
aaa20915 rabbit human antigen specific affinity chromatography followed by protein a supplied as solution form in 0.01m pbs ph7.4 containing 0.05 proclin 300 50 glycerol western blot wb immunocytochemistry icc immunohistochemistry ihc immunoprecipitation ip
blotting 0.5 3ug ml 5 30ug optimal working dilutions must be determined end user sample recombinant apoa4 aaa20915_wb2 lane1 serum lane 2 lung lysate aaa20915_wb3 dab staining on p samples small intestine tissue aaa20915_ihc2 antibody apolipoprotein a4 polyclonal to iv apo aiv apoa 93163358 p06727.3 p06727 q14cw8 q6q787 a8msl6 m13654 mrna organism species homo sapiens source preparation cross reactivity traits liquid immunogen asp173~ser396 accession # expressed e.coli proclin300 blotting0.5 ml5 lane2
⇄⧉products_description => string (1355) "Intended Uses: This ApoC3 ELISA kit is a 1.5 hour solid-phase ELISA designed...
$value[8]['_source']['products_description']
Intended Uses: This ApoC3 ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Monkey ApoC3. This ELISA kit for research use only!<br><br>Principle of the Assay: ApoC3 ELISA kit applies the competitive enzyme immunoassay technique utilizing a monoclonal anti-ApoC3 antibody and an ApoC3-HRP conjugate. The assay sample and buffer are incubated together with ApoC3-HRP conjugate in pre-coated plate for one hour. After the incubation period, the wells are decanted and washed five times. The wells are then incubated with a substrate for HRP enzyme. The product of the enzyme-substrate reaction forms a blue colored complex. Finally, a stop solution is added to stop the reaction, which will then turn the solution yellow. The intensity of color is measured spectrophotometrically at 450nm in a microplate reader. The intensity of the color is inversely proportional to the ApoC3 concentration since ApoC3 from samples and ApoC3-HRP conjugate compete for the anti-ApoC3 antibody binding site. Since the number of sites is limited, as more sites are occupied by ApoC3 from the sample, fewer sites are left to bind ApoC3-HRP conjugate. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The ApoC3 concentration in each sample is interpolated from this standard curve.
⇄⧉ncbi_pathways => string (430) "Chylomicron-mediated Lipid Transport Pathway||106157!!Disease Pathway||53076...
$value[8]['_source']['ncbi_pathways']
Chylomicron-mediated Lipid Transport Pathway||106157!!Disease Pathway||530764!!Diseases Associated With Visual Transduction Pathway||771581!!HDL-mediated Lipid Transport Pathway||106158!!Lipid Digestion, Mobilization, And Transport Pathway||106111!!Lipoprotein Metabolism Pathway||106156!!Metabolism Pathway||477135!!Metabolism Of Lipids And Lipoproteins Pathway||160976!!PPAR Signaling Pathway||83042!!PPAR Signaling Pathway||450
⇄⧉search_terms => string (391) "aaa16933 monkey typical standard curve testing data aaa16933_td elisa kit ap...
$value[8]['_source']['search_terms']
aaa16933 monkey typical standard curve testing data aaa16933_td elisa kit apolipoprotein c3 apoc3 c iii halp2 apociii apo ciii apoc 10,852 da apoc3_human 4557323 np_000031.1 p02656 nm_000040.1 q08e83 q6q786 gene 614028 cardiovascular samples serum plasma cell culture supernatants body fluid and tissue homogenate assay type competitive detection range 50 1000ng ml sensitivity 1.0ng range50
⇄⧉products_description => string (477) "Component of triglyceride-rich very low density lipoproteins (VLDL) and high...
$value[9]['_source']['products_description']
Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma. Plays a multifaceted role in triglyceride homeostasis. Intracellularly, promotes hepatic very low density lipoprotein 1 (VLDL1) assembly and secretion; extracellularly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs). Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by remnant receptors.
⇄⧉products_references => string (521) "Characterization of the mouse apolipoprotein Apoa-1/Apoc-3 gene locus genomi...
$value[9]['_source']['products_references']
Characterization of the mouse apolipoprotein Apoa-1/Apoc-3 gene locus
genomic, mRNA, and protein sequences with comparisons to other species.Januzzi J.L., Azrolan N., O'Connell A., Aalto-Setala K., Breslow J.L.Genomics 14:1081-1088(1992)
Mass spectral analysis of the apolipoproteins on mouse high density lipoproteins. Detection of post-translational modifications.Puppione D.L., Yam L.M., Bassilian S., Souda P., Castellani L.W., Schumaker V.N., Whitelegge J.P.Biochim. Biophys. Acta 1764:1363-1371(2006)
⇄⧉ncbi_pathways => string (505) "Chylomicron-mediated Lipid Transport Pathway||1324269!!HDL-mediated Lipid Tr...
$value[9]['_source']['ncbi_pathways']
Chylomicron-mediated Lipid Transport Pathway||1324269!!HDL-mediated Lipid Transport Pathway||1324270!!Lipid Digestion, Mobilization, And Transport Pathway||1324265!!Lipoprotein Metabolism Pathway||1324268!!Metabolism Pathway||1324226!!Metabolism Of Fat-soluble Vitamins Pathway||1324415!!Metabolism Of Lipids And Lipoproteins Pathway||1324264!!Metabolism Of Vitamins And Cofactors Pathway||1324401!!PPAR (Peroxisome Proliferator-activated Receptor) Signaling Pathway||522983!!PPAR Signaling Pathway||83239
⇄⧉search_terms => string (972) "aaa18490 e coli or yeast baculovirus mammalian cell greater equal to 85 puri...
$value[9]['_source']['search_terms']
aaa18490 e coli or yeast baculovirus mammalian cell greater equal to 85 purity as determined by sds page lyophilized liquid format be during the manufacturing process aaa18490_sds eevegslllgsvqgymeqasktvqdalssvqesdiavvargwmdnhfrflkgywskftdkftgfwdsnpedqptpaies recombinant protein apolipoprotein c iii apoc3 mouse c3 isoform b apo ciii apoc 24.9 kda apoc3_mouse 577019554 np_001276685.1 p33622 nm_001289756.1 q8vc58 q9cpp9 production note special offer host expressed is manufactured from a stock plasmid containing gene colihost stocked in different unit sizes ranging small 10 ug large 1 mg bulk inventory also available has been ordered over and again researchers stood test of time both robust important target for research community it part our new program make most popular targets corresponding hosts expanded with quick processing select fastest delivery among all please contact technical support team email [email protected] more details to85 small10 large1
⇄⧉specificity => string (181) "This assay has high sensitivity and excellent specificity for detection of h...
$value[10]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of human APOM. No significant cross-reactivity or interference between human APOM and analogues was observed.
⇄purity => string (3) "N/A"
$value[10]['_source']['purity']
⇄form => string (3) "N/A"
$value[10]['_source']['form']
⇄concentration => string (3) "N/A"
$value[10]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[10]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[10]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄products_price => string (6) "0.0000"
$value[10]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[10]['_source']['products_weight']
⇄products_status => boolean true
$value[10]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[10]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "700"
$value[10]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[10]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[10]['_source']['language_id']
⇄products_name => string (16) "apolipoprotein M"
$value[10]['_source']['products_name']
⇄products_name_oem => string (38) "Human Apolipoprotein M, APOM ELISA Kit"
Human Apolipoprotein M (APOM) ELISA kit; DADB-127H9.5; G3a; HSPC336; MGC22400; NG20; NG20-like protein; alternative name: G3a; NG20; apolipoprotein M
⇄products_gene_name => string (4) "APOM"
$value[10]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[10]['_source']['products_gene_name_syn']
⇄⧉products_description => string (731) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[10]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for APOM has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any APOM present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for APOM is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of APOM bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄⧉search_terms => string (593) "aaa18227 human this assay has high sensitivity and excellent specificity for...
$value[10]['_source']['search_terms']
aaa18227 human this assay has high sensitivity and excellent specificity for detection of apom no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa18227_td elisa kit apolipoprotein m dadb 127h9.5 g3a hspc336 mgc22400 ng20 like protein alternative name isoform 2 apo 21,253 da apom_human 371873523 np_001243098.1 o95445 nm_001256169.1 q5srp4 q9p046 q9ump6 b0ux98 606907 samples serum plasma cell culture supernates type quantitative sandwich range 1.56 ng ml 100 < 0.39 intra precision within an cv isoform2 ml100
⇄⧉etc_term1 => string (157) "Samples||Serum, Plasma, Cell Culture Supernatants, Body Fluid And Tissue Hom...
$value[11]['_source']['etc_term1']
Samples||Serum, Plasma, Cell Culture Supernatants, Body Fluid And Tissue Homogenate!!Assay Type||Quantitative Competitive or Sandwich!!Sensitivity||0.1ug/mL.
⇄etc_term2 => string (3) "N/A"
$value[11]['_source']['etc_term2']
⇄products_price => string (6) "0.0000"
$value[11]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[11]['_source']['products_weight']
⇄products_status => boolean true
$value[11]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[11]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "720"
$value[11]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[11]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[11]['_source']['language_id']
⇄products_name => string (16) "Apolipoprotein D"
$value[11]['_source']['products_name']
⇄products_name_oem => string (32) "Human Apolipoprotein D ELISA Kit"
$value[11]['_source']['products_name_oem']
⇄products_name_syn => string (3) "N/A"
$value[11]['_source']['products_name_syn']
⇄products_gene_name => string (4) "APOD"
$value[11]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[11]['_source']['products_gene_name_syn']
⇄⧉products_description => string (1453) "Intended Uses: This APOB ELISA kit is a 1.5 hour solid-phase ELISA designed ...
$value[11]['_source']['products_description']
Intended Uses: This APOB ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Rat APOB. This ELISA kit for research use only!<br><br>Principle of the Assay: APOB ELISA kit applies the quantitative sandwich enzyme immunoassay technique. The microtiter plate has been pre-coated with a monoclonal antibody specific for APOB. Standards or samples are then added to the microtiter plate wells and APOB if present, will bind to the antibody pre-coated wells. In order to quantitatively determine the amount of APOB present in the sample, a standardized preparation of horseradish peroxidase (HRP)-conjugated polyclonal antibody, specific for APOB are added to each well to "sandwich" the APOB immobilized on the plate. The microtiter plate undergoes incubation, and then the wells are thoroughly washed to remove all unbound components. Next, substrate solutions are added to each well. The enzyme (HRP) and substrate are allowed to react over a short incubation period. Only those wells that contain APOB and enzyme-conjugated antibody will exhibit a change in color. The enzyme-substrate reaction is terminated by addition of a sulphuric acid solution and the color change is measured spectrophotometrically at a wavelength of 450 nm. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The APOB concentration in each sample is interpolated from this standard curve.
⇄⧉search_terms => string (367) "aaa16193 human typical testing data standard curve for reference only aaa161...
$value[11]['_source']['search_terms']
aaa16193 human typical testing data standard curve for reference only aaa16193_sc elisa kit apolipoprotein d apod apo 21,276 da apod_human 4502163 np_001638.1 p05090 nm_001647.3 q6ibg6 b2r579 d3dnw6 107740 neurobiology samples serum plasma cell culture supernatants body fluid and tissue homogenate assay type quantitative competitive or sandwich sensitivity 0.1ug ml
⇄⧉etc_term1 => string (173) "Samples||Serum, plasma, Cell Culture Supernatants, body fluid and tissue hom...
$value[12]['_source']['etc_term1']
Samples||Serum, plasma, Cell Culture Supernatants, body fluid and tissue homogenate!!Assay Type||Competitive or Sandwich!!Detection Range||25-500ng/mL!!Sensitivity||1.0ng/ml
⇄⧉products_description => string (1463) "Intended Uses: This APOA1 ELISA kit is a 1.5 hour solid-phase ELISA designed...
$value[12]['_source']['products_description']
Intended Uses: This APOA1 ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Rat APOA1. This ELISA kit for research use only!<br><br>Principle of the Assay||APOA1 ELISA kit applies the quantitative sandwich enzyme immunoassay technique. The microtiter plate has been pre-coated with a monoclonal antibody specific for APOA1. Standards or samples are then added to the microtiter plate wells and APOA1 if present, will bind to the antibody pre-coated wells. In order to quantitatively determine the amount of APOA1 present in the sample, a standardized preparation of horseradish peroxidase (HRP)-conjugated polyclonal antibody, specific for APOA1 are added to each well to "sandwich" the APOA1 immobilized on the plate. The microtiter plate undergoes incubation, and then the wells are thoroughly washed to remove all unbound components. Next, substrate solutions are added to each well. The enzyme (HRP) and substrate are allowed to react over a short incubation period. Only those wells that contain APOA1 and enzyme-conjugated antibody will exhibit a change in color. The enzyme-substrate reaction is terminated by addition of a sulphuric acid solution and the color change is measured spectrophotometrically at a wavelength of 450 nm. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The APOA1 concentration in each sample is interpolated from this standard curve.
ABC-family Proteins Mediated Transport Pathway||106573!!ABCA Transporters In Lipid Homeostasis Pathway||477112!!African Trypanosomiasis Pathway||194384!!African Trypanosomiasis Pathway||194323!!Amyloids Pathway||366238!!Binding And Uptake Of Ligands By Scavenger Receptors Pathway||771599!!Chylomicron-mediated Lipid Transport Pathway||106157!!Disease Pathway||530764!!Diseases Associated With Visual Transduction Pathway||771581!!FOXA2 And FOXA3 Transcription Factor Networks Pathway||137911
⇄⧉sp_protein_name_syn => string (160) "Apolipoprotein A1Cleaved into the following 2 chains:Proapolipoprotein A-I; ...
$value[12]['_source']['sp_protein_name_syn']
Apolipoprotein A1Cleaved into the following 2 chains:Proapolipoprotein A-I; ProapoA-I; Truncated apolipoprotein A-IAlternative name(s):Apolipoprotein A-I(1-242)
⇄⧉search_terms => string (525) "aaa16074 rat typical testing data standard curve aaa16074_td elisa kit apoli...
$value[12]['_source']['search_terms']
aaa16074 rat typical testing data standard curve aaa16074_td elisa kit apolipoprotein a1 apoa1 a i preproprotein apo ai 30,778 da a1cleaved into the following 2 chains:proapolipoprotein proapoa truncated ialternative name s 1 242 apoa apoa1_human 4557321 np_000030.1 p02647 nm_000039.1 q6ldn9 q6q785 q9ucs8 q9uct8 a8k866 604091 cardiovascular samples serum plasma cell culture supernatants body fluid and tissue homogenate assay type competitive or sandwich detection range 25 500ng ml sensitivity 1.0ng following2 s1 range25
⇄⧉specificity => string (175) "This assay has high sensitivity and excellent specificity for detection of A...
$value[13]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of ApoB100. No significant cross-reactivity or interference between ApoB100 and analogues was observed.
⇄purity => string (3) "N/A"
$value[13]['_source']['purity']
⇄form => string (3) "N/A"
$value[13]['_source']['form']
⇄concentration => string (3) "N/A"
$value[13]['_source']['concentration']
⇄⧉storage_stability => string (156) "Store entire kit at 2-8C for short-term. For longer-term, please store the m...
$value[13]['_source']['storage_stability']
Store entire kit at 2-8C for short-term. For longer-term, please store the microplate & standard at -20C, while the remaining reagents can be stored at 2-8C
⇄⧉etc_term1 => string (151) "Assay Type||Sandwich!!Samples||Serum, plasma, tissue homogenates and other b...
$value[13]['_source']['etc_term1']
Assay Type||Sandwich!!Samples||Serum, plasma, tissue homogenates and other biological fluids!!Detection Range||93.75-6000ng/ml!!Sensitivity||56.25ng/ml
⇄⧉products_description => string (825) "Principle of the Assay: This kit was based on sandwich enzyme-linked immune-...
$value[13]['_source']['products_description']
Principle of the Assay: This kit was based on sandwich enzyme-linked immune-sorbent assay technology. Capture antibody was pre-coated onto 96-well plates. And the biotin conjugated antibody was used as detection antibodies. The standards, test samples and biotin conjugated detection antibody were added to the wells subsequently, and washed with wash buffer. HRP-Streptavidin was added and unbound conjugates were washed away with wash buffer. TMB substrates were used to visualize HRP enzymatic reaction. TMB was catalyzed by HRP to produce a blue color product that changed into yellow after adding acidic stop solution. The density of yellow is proportional to the target amount of sample captured in plate. Read the O.D. absorbance at 450nm in a microplate reader, and then the concentration of target can be calculated.
⇄⧉ncbi_pathways => string (513) "Binding And Uptake Of Ligands By Scavenger Receptors Pathway||1269897!!Cell ...
$value[13]['_source']['ncbi_pathways']
Binding And Uptake Of Ligands By Scavenger Receptors Pathway||1269897!!Cell Surface Interactions At The Vascular Wall Pathway||1269373!!Chylomicron-mediated Lipid Transport Pathway||1270006!!FOXA1 Transcription Factor Network Pathway||137979!!Fat Digestion And Absorption Pathway||194385!!Fat Digestion And Absorption Pathway||194324!!Hemostasis Pathway||1269340!!LDL-mediated Lipid Transport Pathway||1270008!!Lipid Digestion, Mobilization, And Transport Pathway||1270002!!Lipoprotein Metabolism Pathway||1270005
⇄⧉search_terms => string (676) "aaa17718 monkey this assay has high sensitivity and excellent specificity fo...
$value[13]['_source']['search_terms']
aaa17718 monkey this assay has high sensitivity and excellent specificity for detection of apob100 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa17718_sc elisa kit apolipoprotein b100 b 100 apob fldb ldlcq4 48 515,605 da apo apob_human 105990532 np_000375.2 p04114 nm_000384.2 o00502 p78479 p78480 p78481 q13779 q13785 q13786 q13787 q13788 q4zg63 q53qc8 107730 samples serum plasma tissue homogenates other biological fluids type sandwich range 28.12 1800ng ml < 16ng intra precision within an 3 with low middle level were tested 20 times on one plate respectively cv ldlcq448 an3 tested20
⇄⧉storage_stability => string (202) "For unopened kit, all reagents should be kept according to the labels on via...
$value[14]['_source']['storage_stability']
For unopened kit, all reagents should be kept according to the labels on vials. The TMB Substrate, Wash Buffer, Stop Solution should be stored at 4 degree C. All others should be stored at -20 degree C.
⇄app_tested => string (3) "N/A"
$value[14]['_source']['app_tested']
⇄app_notes => string (3) "N/A"
$value[14]['_source']['app_notes']
⇄testing_protocols => string (3) "N/A"
$value[14]['_source']['testing_protocols']
⇄⧉etc_term1 => string (149) "Samples||Serum, plasma, tissue homogenates and other biological fluids.!!Ass...
$value[14]['_source']['etc_term1']
Samples||Serum, plasma, tissue homogenates and other biological fluids.!!Assay Type||Sandwich!!Detection Range||0.234-15ng/mL!!Sensitivity||0.09ng/mL
⇄⧉ncbi_pathways => string (275) "LDL-mediated Lipid Transport Pathway||1270008!!Lipid Digestion, Mobilization...
$value[14]['_source']['ncbi_pathways']
LDL-mediated Lipid Transport Pathway||1270008!!Lipid Digestion, Mobilization, And Transport Pathway||1270002!!Lipoprotein Metabolism Pathway||1270005!!Metabolism Pathway||1269956!!Metabolism Of Lipids And Lipoproteins Pathway||1270001!!Amb2 Integrin Signaling Pathway||137945
⇄⧉search_terms => string (283) "aaa13970 human elisa kit lipoprotein a lpa lp ak38 apoa sinking pre apolipop...
$value[14]['_source']['search_terms']
aaa13970 human elisa kit lipoprotein a lpa lp ak38 apoa sinking pre apolipoprotein 501,319 da apo 114062 p08519 q5vtd7 q9ud88 x06290 mrna samples serum plasma tissue homogenates and other biological fluids assay type sandwich detection range 0.234 15ng ml sensitivity 0.09ng intra cv
⇄⧉specificity => string (171) "This assay has high sensitivity and excellent specificity for detection of A...
$value[15]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of APOA1. No significant cross-reactivity or interference between APOA1 and analogues was observed.
⇄purity => string (3) "N/A"
$value[15]['_source']['purity']
⇄form => string (3) "N/A"
$value[15]['_source']['form']
⇄concentration => string (3) "N/A"
$value[15]['_source']['concentration']
⇄⧉storage_stability => string (156) "Store entire kit at 2-8C for short-term. For longer-term, please store the m...
$value[15]['_source']['storage_stability']
Store entire kit at 2-8C for short-term. For longer-term, please store the microplate & standard at -20C, while the remaining reagents can be stored at 2-8C
⇄⧉products_description => string (825) "Principle of the Assay: This kit was based on sandwich enzyme-linked immune-...
$value[15]['_source']['products_description']
Principle of the Assay: This kit was based on sandwich enzyme-linked immune-sorbent assay technology. Capture antibody was pre-coated onto 96-well plates. And the biotin conjugated antibody was used as detection antibodies. The standards, test samples and biotin conjugated detection antibody were added to the wells subsequently, and washed with wash buffer. HRP-Streptavidin was added and unbound conjugates were washed away with wash buffer. TMB substrates were used to visualize HRP enzymatic reaction. TMB was catalyzed by HRP to produce a blue color product that changed into yellow after adding acidic stop solution. The density of yellow is proportional to the target amount of sample captured in plate. Read the O.D. absorbance at 450nm in a microplate reader, and then the concentration of target can be calculated.
ABC Transporters In Lipid Homeostasis Pathway||1269905!!ABC-family Proteins Mediated Transport Pathway||1269904!!African Trypanosomiasis Pathway||194384!!African Trypanosomiasis Pathway||194323!!Amyloid Fiber Formation Pathway||1269169!!Binding And Uptake Of Ligands By Scavenger Receptors Pathway||1269897!!Chylomicron-mediated Lipid Transport Pathway||1270006!!FOXA2 And FOXA3 Transcription Factor Networks Pathway||137911!!Fat Digestion And Absorption Pathway||194385!!Fat Digestion And Absorption Pathway||194324
⇄⧉search_terms => string (614) "aaa17743 human this assay has high sensitivity and excellent specificity for...
$value[15]['_source']['search_terms']
aaa17743 human this assay has high sensitivity and excellent specificity for detection of apoa1 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa17743_sc elisa kit apolipoprotein a i apo a1 alp 1 brp 14 ltw lvtw sep 2 ai apoa mgc117399 isoform preproprotein 30,778 da proapoa apoa1_human 966751413 np_001304947.1 p02647 nm_001318018.1 q6ldn9 q6q785 q9ucs8 q9uct8 a8k866 105200 samples serum plasma tissue homogenates other biological fluids type quantitative sandwich range 0.313 20ng ml 0.188ng intra precision cv alp1 brp14 sep2
⇄⧉specificity => string (376) "This assay has high sensitivity and excellent specificity for detection of L...
$value[16]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of LTC4. No significant cross-reactivity or interference between LTC4 and analogues was observed. NOTE: Limited by current skills and knowledge, it is impossible for us to complete the cross-reactivity detection between LTC4 and all the analogues, therefore, cross reaction may still exist in some cases.
⇄purity => string (3) "N/A"
$value[16]['_source']['purity']
⇄form => string (3) "N/A"
$value[16]['_source']['form']
⇄concentration => string (3) "N/A"
$value[16]['_source']['concentration']
⇄storage_stability => string (35) "Store all reagents at 2-8 degree C."
⇄⧉products_description => string (1390) "Principle of the Assay: LTC4 ELISA kit applies the competitive enzyme immuno...
$value[16]['_source']['products_description']
Principle of the Assay: LTC4 ELISA kit applies the competitive enzyme immunoassay technique utilizing a polyclonal anti-LTC4 antibody and an LTC4-HRP conjugate. The assay sample and buffer are incubated together with LTC4-HRP conjugate in pre-coated plate for one hour. After the incubation period, the wells are decanted and washed five times. The wells are then incubated with a substrate for HRP enzyme. The product of the enzyme-substrate reaction forms a blue colored complex. Finally, a stop solution is added to stop the reaction, which will then turn the solution yellow. The intensity of color is measured spectrophotometrically at 450nm in a microplate reader. The intensity of the color is inversely proportional to the LTC4 concentration since LTC4 from samples and LTC4-HRP conjugate compete for the anti-LTC4 antibody binding site. Since the number of sites is limited, as more sites are occupied by LTC4 from the sample, fewer sites are left to bind LTC4-HRP conjugate. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The LTC4 concentration in each sample is interpolated from this standard curve.<br><br>Intended Uses: This LTC4 ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Monkey LTC4. This ELISA kit for research use only, not for therapeutic or diagnostic applications!
⇄⧉specificity => string (361) "This assay has high sensitivity and excellent specificity for detection of A...
$value[17]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of ApoB . No significant cross-reactivity or interference between ApoB and analogues was observed. Note: Limited by current skills and knowledge, it is difficult for us to complete the crossreactivity detection between ApoB and all the analogues, therefore, cross reaction may still exist.
⇄purity => string (3) "N/A"
$value[17]['_source']['purity']
⇄form => string (3) "N/A"
$value[17]['_source']['form']
⇄concentration => string (3) "N/A"
$value[17]['_source']['concentration']
⇄⧉storage_stability => string (156) "Store entire kit at 2-8C for short-term. For longer-term, please store the m...
$value[17]['_source']['storage_stability']
Store entire kit at 2-8C for short-term. For longer-term, please store the microplate & standard at -20C, while the remaining reagents can be stored at 2-8C
Assay Type||Sandwich ELISA, Double Antibody!!Samples||Serum, Plasma, Cell Culture Supernatant, cell or tissue lysate, Other liquid samples!!Detection Range||0.313-20ug/ml!!Sensitivity||0.188ug/ml
⇄⧉etc_term2 => string (414) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): 3 ...
$value[17]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): 3 samples with low, middle and high level ApoB were tested 20 times on one plate, respectively. Intra-Assay: CV<8%!!Inter-assay Precision||Inter-assay Precision (Precision between assays): 3 samples with low, middle and high level ApoB were tested on 3 different plates, 8 replicates in each plate. CV (%) = SD/meanX100. Inter-Assay: CV<10%
⇄products_price => string (6) "0.0000"
$value[17]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[17]['_source']['products_weight']
⇄products_status => boolean true
$value[17]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[17]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "760"
$value[17]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[17]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[17]['_source']['language_id']
⇄products_name => string (16) "Apolipoprotein B"
$value[17]['_source']['products_name']
⇄products_name_oem => string (32) "Mouse Apolipoprotein B ELISA Kit"
⇄⧉products_description => string (834) "Principle of the Assay: This kit was based on sandwich enzyme-linked immune-...
$value[17]['_source']['products_description']
Principle of the Assay: This kit was based on sandwich enzyme-linked immune-sorbent assay technology. Anti- ApoB antibody was pre-coated onto 96-well plates. And the biotin conjugated anti- ApoB antibody was used as detection antibodies. The standards, test samples and biotin conjugated detection antibody were added to the wells subsequently, and washed with wash buffer. HRPStreptavidin was added and unbound conjugates were washed away with wash buffer. TMB substrates were used to visualize HRP enzymatic reaction. TMB was catalyzed by HRP to produce a blue color product that changed into yellow after adding acidic stop solution. The density of yellow is proportional to the ApoB amount of sample captured in plate. Read the O.D. absorbance at 450nm in a microplate reader, and then the concentration of ApoB can be calculated.
⇄⧉ncbi_pathways => string (513) "Binding And Uptake Of Ligands By Scavenger Receptors Pathway||1269897!!Cell ...
$value[17]['_source']['ncbi_pathways']
Binding And Uptake Of Ligands By Scavenger Receptors Pathway||1269897!!Cell Surface Interactions At The Vascular Wall Pathway||1269373!!Chylomicron-mediated Lipid Transport Pathway||1270006!!FOXA1 Transcription Factor Network Pathway||137979!!Fat Digestion And Absorption Pathway||194385!!Fat Digestion And Absorption Pathway||194324!!Hemostasis Pathway||1269340!!LDL-mediated Lipid Transport Pathway||1270008!!Lipid Digestion, Mobilization, And Transport Pathway||1270002!!Lipoprotein Metabolism Pathway||1270005
⇄⧉search_terms => string (680) "aaa17736 mouse this assay has high sensitivity and excellent specificity for...
$value[17]['_source']['search_terms']
aaa17736 mouse this assay has high sensitivity and excellent specificity for detection of apob no significant cross reactivity or interference between analogues was observed note limited by current skills knowledge it is difficult us to complete the crossreactivity all therefore reaction may still exist typical testing data standard curve reference only aaa17736_td elisa kit apolipoprotein b apo fldb ldlcq4 partial 48 100 515,605 da apob_human 553189 aaa51752.1 p04114 o00502 p78479 p78480 p78481 q13779 q13785 q13786 q13787 q13788 q4zg63 q53qc8 107730 samples serum plasma tissue homogenates other biological fluids type sandwich double antibody range 0.312 20?g ml partial48
⇄⧉specificity => string (183) "This assay has high sensitivity and excellent specificity for detection of m...
$value[18]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of monkey APOE. No significant cross-reactivity or interference between monkey APOE and analogues was observed.
⇄purity => string (3) "N/A"
$value[18]['_source']['purity']
⇄form => string (3) "N/A"
$value[18]['_source']['form']
⇄concentration => string (3) "N/A"
$value[18]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[18]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[18]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄products_price => string (6) "0.0000"
$value[18]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[18]['_source']['products_weight']
⇄products_status => boolean true
$value[18]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[18]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "700"
$value[18]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[18]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[18]['_source']['language_id']
⇄products_name => string (16) "apolipoprotein E"
$value[18]['_source']['products_name']
⇄products_name_oem => string (39) "Monkey Apolipoprotein E, APOE ELISA Kit"
Monkey Apolipoprotein E (APOE) ELISA kit; AD2; LDLCQ5; LPG; MGC1571; apolipoprotein E3; apolipoprotein E
⇄products_gene_name => string (4) "APOE"
$value[18]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[18]['_source']['products_gene_name_syn']
⇄⧉products_description => string (621) "Principle of the Assay: This assay employs the competitive inhibition enzyme...
$value[18]['_source']['products_description']
Principle of the Assay: This assay employs the competitive inhibition enzyme immunoassay technique. The microtiter plate provided in this kit has been pre-coated with APOE. Standards or samples are added to the appropriate microtiter plate wells with Horseradish Peroxidase (HRP) conjugated antibody preparation specific for APOE. The competitive inhibition reaction is launched between with pre-coated APOE and APOE in samples. A substrate solution is added to the wells and the color develops in opposite to the amount of APOE in the samples. The color development is stopped and the intensity of the color is measured.
⇄⧉search_terms => string (600) "aaa18182 monkey this assay has high sensitivity and excellent specificity fo...
$value[18]['_source']['search_terms']
aaa18182 monkey this assay has high sensitivity and excellent specificity for detection of apoe no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa18182_td elisa kit apolipoprotein e ad2 ldlcq5 lpg mgc1571 e3 apo 12,382 da apoe_macmu 3913070 q28502.1 q28502 samples serum plasma cell culture supernates saliva tissue homogenates type quantitative competitive range 6.25 ng ml 400 < 1.56 intra precision within an cv <8 three known concentration were tested twenty times on one plate to assess inter assays <10 in ml400
⇄⧉specificity => string (179) "This assay has high sensitivity and excellent specificity for detection of r...
$value[19]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of rat Apo-E. No significant cross-reactivity or interference between rat Apo-E and analogues was observed.
⇄purity => string (3) "N/A"
$value[19]['_source']['purity']
⇄form => string (3) "N/A"
$value[19]['_source']['form']
⇄concentration => string (3) "N/A"
$value[19]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[19]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[19]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄products_price => string (6) "0.0000"
$value[19]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[19]['_source']['products_weight']
⇄products_status => boolean true
$value[19]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[19]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "700"
$value[19]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[19]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[19]['_source']['language_id']
⇄products_name => string (16) "apolipoprotein E"
$value[19]['_source']['products_name']
⇄products_name_oem => string (37) "Rat apolipoprotein E, Apo-E ELISA Kit"
Rat apolipoprotein E (Apo-E) ELISA Kit; AD2; LDLCQ5; LPG; MGC1571; apolipoprotein E3; Rat apolipoprotein E (Apo-E)
⇄products_gene_name => string (4) "APOE"
$value[19]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[19]['_source']['products_gene_name_syn']
⇄⧉products_description => string (626) "Principle of the Assay: This assay employs the competitive inhibition enzyme...
$value[19]['_source']['products_description']
Principle of the Assay: This assay employs the competitive inhibition enzyme immunoassay technique. The microtiter plate provided in this kit has been pre-coated with Apo-E. Standards or samples are added to the appropriate microtiter plate wells with Horseradish Peroxidase (HRP) conjugated antibody preparation specific for Apo-E. The competitive inhibition reaction is launched between with pre-coated Apo-E and Apo-E in samples. A substrate solution is added to the wells and the color develops in opposite to the amount of Apo-E in the samples. The color development is stopped and the intensity of the color is measured.
Alzheimer's Disease Pathway||83097!!Alzheimer's Disease Pathway||509!!Chylomicron-mediated Lipid Transport Pathway||106157!!HDL-mediated Lipid Transport Pathway||106158!!Lipid Digestion, Mobilization, And Transport Pathway||106111!!Lipoprotein Metabolism Pathway||106156!!Metabolism Pathway||477135!!Metabolism Of Lipids And Lipoproteins Pathway||160976!!Statin Pathway||198852
⇄⧉search_terms => string (603) "aaa15131 rat this assay has high sensitivity and excellent specificity for d...
$value[19]['_source']['search_terms']
aaa15131 rat this assay has high sensitivity and excellent specificity for detection of apo e no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa15131_td elisa kit apolipoprotein ad2 ldlcq5 lpg mgc1571 e3 apoe 35,497 da apoe_rabit 130488075 np_001076112.1 p18287 nm_001082643.1 samples serum plasma tissue homogenates cell culture supernates type quantitative competitive range 15.6 ng ml 1000 < intra precision within an cv <8 three known concentration were tested twenty times on one plate to assess inter assays <10 in
