Highly validated and characterized monoclonal/polyclonal
antibodies and recombinant
proteins
The majority of AAA Biotech’s antibodies are highly validated and can be use in multiple
applications such as ELISA, FC,
ICC, IF, IHC, IP, WB, etc. We have antibodies available for rare species, in multiple conjugated
forms or recombinant
antibodies.
As for our high quality proteins, the majority have 90% purity, detected by SDS-PAGE while some are
available in
different tags such as Flag, GST, His, MBP, etc. We also carry high quality native and biologically
active proteins.
AAA Biotech is constantly working to expand our capacity to provide recombinant proteins and
antibodies to most
target proteins.
SELECT `p`.*, `pd`.*, IFNULL(pdns.ncbi_summary, "N/A") as ncbi_summary_pdns, IFNULL(pdns.sp_comments, "N/A") as sp_comments_pdns, IFNULL(pdns.ncbi_research_articles, "N/A") as ncbi_research_articles_pdns, IFNULL(pe.products_description_extra, "N/A") as products_description_extra
FROM (`products`, `products` as `p`)
LEFT OUTER JOIN `products_description` as `pd` ON `p`.`products_id` = `pd`.`products_id`
LEFT OUTER JOIN `products_description_ncbi_sp` as `pdns` ON `p`.`products_id` = `pdns`.`products_id`
LEFT OUTER JOIN `products_extra` as `pe` ON `p`.`products_id` = `pe`.`products_id`
WHERE `p`.`products_id` = '26334'
AND `pd`.`language_id` = 1
LIMIT 1
Query
Database
1.95 ms
select p.*, pd.*,
ifnull(pdns.ncbi_summary, 'N/A') as ncbi_summary_pdns,
ifnull(pdns.sp_comments, 'N/A') as sp_comments_pdns,
ifnull(pdns.ncbi_research_articles, 'N/A') as ncbi_research_articles_pdns,
ifnull(pe.products_description_extra, 'N/A') as products_description_extra
from products p
LEFT OUTER JOIN products_description pd on p.products_id = pd.products_id
LEFT OUTER JOIN products_description_ncbi_sp pdns on p.products_id = pdns.products_id
LEFT OUTER JOIN products_extra pe on p.products_id = pe.products_id
where p.products_id = '26334' and pd.language_id = 1
Query
Database
1.54 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '26334'
Database (4 total Queries, 4 of them unique across 2 Connections)
Time
Query String
2.49 ms
SELECT `p`.*, `pd`.*, IFNULL(pdns.ncbi_summary, "N/A") as ncbi_summary_pdns, IFNULL(pdns.sp_comments, "N/A") as sp_comments_pdns, IFNULL(pdns.ncbi_research_articles, "N/A") as ncbi_research_articles_pdns, IFNULL(pe.products_description_extra, "N/A") as products_description_extra
FROM (`products`, `products` as `p`)
LEFT OUTER JOIN `products_description` as `pd` ON `p`.`products_id` = `pd`.`products_id`
LEFT OUTER JOIN `products_description_ncbi_sp` as `pdns` ON `p`.`products_id` = `pdns`.`products_id`
LEFT OUTER JOIN `products_extra` as `pe` ON `p`.`products_id` = `pe`.`products_id`
WHERE `p`.`products_id` = '26334'
AND `pd`.`language_id` = 1
LIMIT 1
select p.*, pd.*,
ifnull(pdns.ncbi_summary, 'N/A') as ncbi_summary_pdns,
ifnull(pdns.sp_comments, 'N/A') as sp_comments_pdns,
ifnull(pdns.ncbi_research_articles, 'N/A') as ncbi_research_articles_pdns,
ifnull(pe.products_description_extra, 'N/A') as products_description_extra
from products p
LEFT OUTER JOIN products_description pd on p.products_id = pd.products_id
LEFT OUTER JOIN products_description_ncbi_sp pdns on p.products_id = pdns.products_id
LEFT OUTER JOIN products_extra pe on p.products_id = pe.products_id
where p.products_id = '26334' and pd.language_id = 1
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '26334'
⇄⧉form => string (107) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Flu...
$value['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
⇄concentration => string (3) "N/A"
$value['concentration']
⇄⧉storage_stability => string (486) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.<br><br>FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄app_tested => string (70) "Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)"
$value['app_tested']
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value['app_notes']
⇄⧉testing_protocols => string (948) "Application Data||Detection limit for recombinant GST tagged TFAP4 is approx...
$value['testing_protocols']
Application Data||Detection limit for recombinant GST tagged TFAP4 is approximately 0.1ng/ml as a capture antibody.||AAA26334_APP6.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to TFAP4 on formalin-fixed paraffin-embedded human uterine cervix. [antibody concentration 1 ug/ml]||AAA26334_IHC5.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to TFAP4 on formalin-fixed paraffin-embedded human uterine cervix. [antibody concentration 1 ug/ml]||AAA26334_IHC4.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to TFAP4 on HeLa cell. [antibody concentration 10 ug/ml]||AAA26334_IF3.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to TFAP4 on HeLa cell. [antibody concentration 10 ug/ml]||AAA26334_IF2.jpg!!WB (Western Blot)||TFAP4 monoclonal antibody (M01), clone 6B1 Western Blot analysis of TFAP4 expression in Hela S3 NE (Cat # L013V3).||AAA26334_WB.jpg
⇄⧉etc_term1 => string (254) "Immunogen||TFAP4 (NP_003214, 93aa-192aa) partial recombinant protein with GS...
$value['etc_term1']
Immunogen||TFAP4 (NP_003214, 93aa-192aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||AEYIFSLEQEKTRLLQQNTQLKRFIQELSGSSPKRRRAEDKDEGIGSPDIWEDEKAEDLRREMIELRQQLDKERSVRMMLEEQVRSLEAHMYPEKLKVIA!!Conjugate||FITC
Transcription Factor AP-4 (Activating Enhancer Binding Protein 4); AP-4; bHLHc41
⇄products_gene_name => string (5) "TFAP4"
$value['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value['products_gene_name_syn']
⇄⧉products_description => string (400) "Transcription factors of the basic helix-loop-helix-zipper (bHLH-ZIP) family...
$value['products_description']
Transcription factors of the basic helix-loop-helix-zipper (bHLH-ZIP) family contain a basic domain, which is used for DNA binding, and HLH and ZIP domains, which are used for oligomerization. Transcription factor AP4 activates both viral and cellular genes by binding to the symmetrical DNA sequence CAGCTG (Mermod et al., 1988 [PubMed 2833704]; Hu et al., 1990 [PubMed 2123466]). [supplied by OMIM]
⇄⧉form => string (107) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Flu...
$value->a['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
⇄concentration => string (3) "N/A"
$value->a['concentration']
⇄⧉storage_stability => string (486) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value->a['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.<br><br>FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄app_tested => string (70) "Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)"
$value->a['app_tested']
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value->a['app_notes']
⇄⧉testing_protocols => string (948) "Application Data||Detection limit for recombinant GST tagged TFAP4 is approx...
$value->a['testing_protocols']
Application Data||Detection limit for recombinant GST tagged TFAP4 is approximately 0.1ng/ml as a capture antibody.||AAA26334_APP6.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to TFAP4 on formalin-fixed paraffin-embedded human uterine cervix. [antibody concentration 1 ug/ml]||AAA26334_IHC5.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to TFAP4 on formalin-fixed paraffin-embedded human uterine cervix. [antibody concentration 1 ug/ml]||AAA26334_IHC4.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to TFAP4 on HeLa cell. [antibody concentration 10 ug/ml]||AAA26334_IF3.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to TFAP4 on HeLa cell. [antibody concentration 10 ug/ml]||AAA26334_IF2.jpg!!WB (Western Blot)||TFAP4 monoclonal antibody (M01), clone 6B1 Western Blot analysis of TFAP4 expression in Hela S3 NE (Cat # L013V3).||AAA26334_WB.jpg
⇄⧉etc_term1 => string (254) "Immunogen||TFAP4 (NP_003214, 93aa-192aa) partial recombinant protein with GS...
$value->a['etc_term1']
Immunogen||TFAP4 (NP_003214, 93aa-192aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||AEYIFSLEQEKTRLLQQNTQLKRFIQELSGSSPKRRRAEDKDEGIGSPDIWEDEKAEDLRREMIELRQQLDKERSVRMMLEEQVRSLEAHMYPEKLKVIA!!Conjugate||FITC
Transcription Factor AP-4 (Activating Enhancer Binding Protein 4); AP-4; bHLHc41
⇄products_gene_name => string (5) "TFAP4"
$value->a['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value->a['products_gene_name_syn']
⇄⧉products_description => string (400) "Transcription factors of the basic helix-loop-helix-zipper (bHLH-ZIP) family...
$value->a['products_description']
Transcription factors of the basic helix-loop-helix-zipper (bHLH-ZIP) family contain a basic domain, which is used for DNA binding, and HLH and ZIP domains, which are used for oligomerization. Transcription factor AP4 activates both viral and cellular genes by binding to the symmetrical DNA sequence CAGCTG (Mermod et al., 1988 [PubMed 2833704]; Hu et al., 1990 [PubMed 2123466]). [supplied by OMIM]
⇄⧉form => string (107) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Flu...
$value->d['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
⇄concentration => string (3) "N/A"
$value->d['concentration']
⇄⧉storage_stability => string (486) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value->d['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.<br><br>FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄app_tested => string (70) "Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)"
$value->d['app_tested']
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value->d['app_notes']
⇄⧉testing_protocols => string (948) "Application Data||Detection limit for recombinant GST tagged TFAP4 is approx...
$value->d['testing_protocols']
Application Data||Detection limit for recombinant GST tagged TFAP4 is approximately 0.1ng/ml as a capture antibody.||AAA26334_APP6.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to TFAP4 on formalin-fixed paraffin-embedded human uterine cervix. [antibody concentration 1 ug/ml]||AAA26334_IHC5.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to TFAP4 on formalin-fixed paraffin-embedded human uterine cervix. [antibody concentration 1 ug/ml]||AAA26334_IHC4.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to TFAP4 on HeLa cell. [antibody concentration 10 ug/ml]||AAA26334_IF3.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to TFAP4 on HeLa cell. [antibody concentration 10 ug/ml]||AAA26334_IF2.jpg!!WB (Western Blot)||TFAP4 monoclonal antibody (M01), clone 6B1 Western Blot analysis of TFAP4 expression in Hela S3 NE (Cat # L013V3).||AAA26334_WB.jpg
⇄⧉etc_term1 => string (254) "Immunogen||TFAP4 (NP_003214, 93aa-192aa) partial recombinant protein with GS...
$value->d['etc_term1']
Immunogen||TFAP4 (NP_003214, 93aa-192aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||AEYIFSLEQEKTRLLQQNTQLKRFIQELSGSSPKRRRAEDKDEGIGSPDIWEDEKAEDLRREMIELRQQLDKERSVRMMLEEQVRSLEAHMYPEKLKVIA!!Conjugate||FITC
Transcription Factor AP-4 (Activating Enhancer Binding Protein 4); AP-4; bHLHc41
⇄products_gene_name => string (5) "TFAP4"
$value->d['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value->d['products_gene_name_syn']
⇄⧉products_description => string (400) "Transcription factors of the basic helix-loop-helix-zipper (bHLH-ZIP) family...
$value->d['products_description']
Transcription factors of the basic helix-loop-helix-zipper (bHLH-ZIP) family contain a basic domain, which is used for DNA binding, and HLH and ZIP domains, which are used for oligomerization. Transcription factor AP4 activates both viral and cellular genes by binding to the symmetrical DNA sequence CAGCTG (Mermod et al., 1988 [PubMed 2833704]; Hu et al., 1990 [PubMed 2123466]). [supplied by OMIM]
⇄⧉products_description => string (1089) "Background: This Quantitative Sandwich ELISA kit is for lab reagent/research...
$value[0]['_source']['products_description']
Background: This Quantitative Sandwich ELISA kit is for lab reagent/research use only, not for drug, household, therapeutic or diagnostic applications! This kit is intended to be used for determine the level of IgLL1 (hereafter termed "analyte") in undiluted original Pigeon serum, plasma or tissue homogenates samples. For other sample types please contact tech support to determine compatibility with this assay. This kit is not suitable for assaying non-biological sources of substances.<br><br>Principle of the Assay: The kit uses a sandwich enzyme-linked immunosorbent assay (ELISA) to qualitatively analyze Human Coronavirus HKU- 39849 Nucleocapsid Antibody (Anti-HCoV-HKU-NP) in Human serum, plasma. This kit is in vitro research use only! Not for therapeutic or diagnostic applications!<br><br>Intended Uses: The kit uses a sandwich enzyme-linked immunosorbent assay (ELISA) to qualitatively analyze Human Coronavirus HKU- 39849 Nucleocapsid Antibody (Anti-HCoV-HKU-NP) in Human serum, plasma. This kit is in vitro research use only! Not for therapeutic or diagnostic applications!
⇄products_references => string (3) "N/A"
$value[0]['_source']['products_references']
⇄products_related_diseases => string (3) "N/A"
$value[0]['_source']['products_related_diseases']
⇄products_categories => string (3) "N/A"
$value[0]['_source']['products_categories']
⇄ncbi_full_name => string (3) "N/A"
$value[0]['_source']['ncbi_full_name']
⇄ncbi_full_name_syn => string (3) "N/A"
$value[0]['_source']['ncbi_full_name_syn']
⇄ncbi_symbol => string (3) "N/A"
$value[0]['_source']['ncbi_symbol']
⇄ncbi_symbol_syn => string (3) "N/A"
$value[0]['_source']['ncbi_symbol_syn']
⇄ncbi_protein_info => string (3) "N/A"
$value[0]['_source']['ncbi_protein_info']
⇄ncbi_chrom_loc => string (3) "N/A"
$value[0]['_source']['ncbi_chrom_loc']
⇄ncbi_gene_id => string (3) "N/A"
$value[0]['_source']['ncbi_gene_id']
⇄ncbi_mol_weight => string (3) "N/A"
$value[0]['_source']['ncbi_mol_weight']
⇄ncbi_pathways => string (3) "N/A"
$value[0]['_source']['ncbi_pathways']
⇄sp_protein_name => string (3) "N/A"
$value[0]['_source']['sp_protein_name']
⇄sp_protein_name_syn => string (3) "N/A"
$value[0]['_source']['sp_protein_name_syn']
⇄sp_gene_name => string (3) "N/A"
$value[0]['_source']['sp_gene_name']
⇄sp_gene_name_syn => string (3) "N/A"
$value[0]['_source']['sp_gene_name_syn']
⇄sp_entry_name => string (3) "N/A"
$value[0]['_source']['sp_entry_name']
⇄sp_mim => string (3) "N/A"
$value[0]['_source']['sp_mim']
⇄sp_interactions => string (3) "N/A"
$value[0]['_source']['sp_interactions']
⇄products_url => string (3) "N/A"
$value[0]['_source']['products_url']
⇄products_viewed => string (1) "0"
$value[0]['_source']['products_viewed']
⇄⧉search_terms => string (156) "aaa31555 human elisa kit coronavirus antibody anti hcov hku 39849 np hku1 as...
$value[0]['_source']['search_terms']
aaa31555 human elisa kit coronavirus antibody anti hcov hku 39849 np hku1 assay type qualitative sandwich intra precision cv are less than 15 inter ? than15
⇄⧉etc_term2 => string (122) "Intra-assay Precision||Intra-assay CV (%) are less than 15%.!!Inter-assay Pr...
$value[1]['_source']['etc_term2']
Intra-assay Precision||Intra-assay CV (%) are less than 15%.!!Inter-assay Precision||Inter-assay CV (?) are less than 15%.
⇄products_price => string (6) "0.0000"
$value[1]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[1]['_source']['products_weight']
⇄products_status => boolean true
$value[1]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[1]['_source']['products_tax_class_id']
⇄manufacturers_id => string (1) "1"
$value[1]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[1]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[1]['_source']['language_id']
⇄products_name => string (33) "Hepatitis D Virus Antigen (HDVAg)"
$value[1]['_source']['products_name']
⇄products_name_oem => string (61) "Qualitative Human Hepatitis D Virus Antigen (HDVAg) ELISA Kit"
$value[1]['_source']['products_name_oem']
⇄products_name_syn => string (3) "N/A"
$value[1]['_source']['products_name_syn']
⇄products_gene_name => string (5) "HDVAg"
$value[1]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[1]['_source']['products_gene_name_syn']
⇄⧉products_description => string (1024) "Intended Uses: The kit uses a sandwich enzyme-linked immunosorbent assay (EL...
$value[1]['_source']['products_description']
Intended Uses: The kit uses a sandwich enzyme-linked immunosorbent assay (ELISA) to qualitatively analyze Human Hepatitis D Virus Antigen (HDVAg) in Human serum, plasma. This kit is in vitro research use only! Not for therapeutic or test applications!<br><br>Principle of the Assay: The kit uses a sandwich enzyme-linked immunosorbent assay (ELISA) to qualitatively analyze Human Hepatitis D Virus Antigen (HDVAg) in Human serum, plasma. This kit is in vitro research use only! Not for therapeutic or test applications!<br><br>Background/Introduction: This Quantitative Sandwich ELISA kit is for lab reagent/research use only, not for drug, household, therapeutic or test applications! This kit is intended to be used for determine the level of HBVCAg (hereafter termed "analyte") in undiluted original Human serum, plasma or tissue homogenates samples. For other sample types please contact tech support to determine compatibility with this assay. This kit is not suitable for assaying non-biological sources of substances.
⇄products_references => string (3) "N/A"
$value[1]['_source']['products_references']
⇄products_related_diseases => string (3) "N/A"
$value[1]['_source']['products_related_diseases']
⇄products_categories => string (3) "N/A"
$value[1]['_source']['products_categories']
⇄ncbi_full_name => string (3) "N/A"
$value[1]['_source']['ncbi_full_name']
⇄ncbi_full_name_syn => string (3) "N/A"
$value[1]['_source']['ncbi_full_name_syn']
⇄ncbi_symbol => string (3) "N/A"
$value[1]['_source']['ncbi_symbol']
⇄ncbi_symbol_syn => string (3) "N/A"
$value[1]['_source']['ncbi_symbol_syn']
⇄ncbi_protein_info => string (3) "N/A"
$value[1]['_source']['ncbi_protein_info']
⇄ncbi_chrom_loc => string (3) "N/A"
$value[1]['_source']['ncbi_chrom_loc']
⇄ncbi_gene_id => string (3) "N/A"
$value[1]['_source']['ncbi_gene_id']
⇄ncbi_mol_weight => string (3) "N/A"
$value[1]['_source']['ncbi_mol_weight']
⇄ncbi_pathways => string (3) "N/A"
$value[1]['_source']['ncbi_pathways']
⇄sp_protein_name => string (3) "N/A"
$value[1]['_source']['sp_protein_name']
⇄sp_protein_name_syn => string (3) "N/A"
$value[1]['_source']['sp_protein_name_syn']
⇄sp_gene_name => string (3) "N/A"
$value[1]['_source']['sp_gene_name']
⇄sp_gene_name_syn => string (3) "N/A"
$value[1]['_source']['sp_gene_name_syn']
⇄sp_entry_name => string (3) "N/A"
$value[1]['_source']['sp_entry_name']
⇄sp_mim => string (3) "N/A"
$value[1]['_source']['sp_mim']
⇄sp_interactions => string (3) "N/A"
$value[1]['_source']['sp_interactions']
⇄products_url => string (3) "N/A"
$value[1]['_source']['products_url']
⇄products_viewed => string (1) "0"
$value[1]['_source']['products_viewed']
⇄⧉search_terms => string (173) "aaa10551 human elisa kit hepatitis d virus antigen hdvag qualitative samples...
$value[1]['_source']['search_terms']
aaa10551 human elisa kit hepatitis d virus antigen hdvag qualitative samples serum plasma assay type quantitative sandwich intra precision cv are less than 15 inter ? than15
⇄⧉specificity => string (171) "This assay has high sensitivity and excellent specificity for detection of I...
$value[2]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of ITGb1. No significant cross-reactivity or interference between ITGb1 and analogues was observed.
⇄purity => string (3) "N/A"
$value[2]['_source']['purity']
⇄form => string (3) "N/A"
$value[2]['_source']['form']
⇄concentration => string (3) "N/A"
$value[2]['_source']['concentration']
⇄⧉storage_stability => string (475) "The stability of kit is determined by the loss rate of activity. The loss ra...
$value[2]['_source']['storage_stability']
The stability of kit is determined by the loss rate of activity. The loss rate of this kit is less than 5% within the expiration date under appropriate storage condition. <br>To minimize extra influence on the performance, operation procedures and lab conditions, especially room temperature, air humidity, incubator temperature should be strictly controlled. It is also strongly suggested that the whole assay is performed by the same operator from the beginning to the end.
Assay Type||Double-antibody Sandwich!!Samples||Tissue homogenates, Cell lysates, Cell culture supernates and other biological fluids!!Detection Range||0.78-50ng/mL!!Sensitivity||0.35ng/mL
⇄⧉etc_term2 => string (416) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): 3 ...
$value[2]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): 3 samples with low, middle and high level ITGb1 were tested 20 times on one plate, respectively. Intra-Assay: CV<10%!!Inter-assay Precision||Inter-assay Precision (Precision between assays): 3 samples with low, middle and high level ITGb1 were tested on 3 different plates, 8 replicates in each plate. CV(%) = SD/meanX100. Inter-Assay: CV<12%
⇄⧉products_description => string (1013) "Intended Uses: The kit is a sandwich enzyme immunoassay for in vitro quantit...
$value[2]['_source']['products_description']
Intended Uses: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of ITGb1 in human tissue homogenates, cell lysates, cell culture supernates and other biological fluids.<br><br>Principle of the Assay: The microplate provided in this kit has been pre-coated with an antibody specific to ITGb1. Standards or samples are then added to the appropriate microplate wells with a biotin-conjugated antibody specific to ITGb1. Next, Avidin conjugated to Horseradish Peroxidase (HRP) is added to each microplate well and incubated. After TMB substrate solution is added, only those wells that contain ITGb1, biotin-conjugated antibody and enzyme-conjugated Avidin will exhibit a change in color. The enzyme-substrate reaction is terminated by the addition of sulphuric acid solution and the color change is measured spectrophotometrically at a wavelength of 450nm +/- 10nm. The concentration of ITGb1 in the samples is then determined by comparing the O.D. of the samples to the standard curve.
⇄products_references => string (3) "N/A"
$value[2]['_source']['products_references']
⇄⧉products_related_diseases => string (210) "Carcinoma||18!!Neoplasm Metastasis||11!!Inflammation||9!!Nervous System Dise...
$value[2]['_source']['products_related_diseases']
Carcinoma||18!!Neoplasm Metastasis||11!!Inflammation||9!!Nervous System Diseases||9!!Neoplasm Invasiveness||9!!Disease Models, Animal||8!!Fibrosis||6!!Cardiovascular Diseases||5!!Kidney Diseases||4!!Necrosis||4
⇄⧉search_terms => string (701) "aaa20576 human this assay has high sensitivity and excellent specificity for...
$value[2]['_source']['search_terms']
aaa20576 human this assay has high sensitivity and excellent specificity for detection of itgb1 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa20576_sc elisa kit integrin beta 1 cd29 msk12 itg b1 fnrb gpiia mdf2 vlab fibronectin receptor polypeptide antigen includes glycoprotein iia vla 4 subunit 88,884 da cd_antigen itb1_human 218563324 p05556.2 p05556 p78466 p78467 q13089 q13090 q13091 q13212 a8k6n2 d3drx9 d3dry3 d3dry4 d3dry5 135630 cd adhesion molecule tumor immunity samples tissue homogenates cell lysates culture supernates other biological fluids type quantitative sandwich range 0.78 50ng ml beta1 vla4
Recognizes the murine integrin beta 1 subunit. Inhibits beta 1 integrin mediated adhesion. Species Crossreactivity: rat.
⇄purity => string (67) "Affinity Purified<br>Purified by Protein G affinity chromatography."
$value[3]['_source']['purity']
⇄form => string (56) "Supplied as a liquid in PBS, pH 7.4, 0.09% sodium azide."
$value[3]['_source']['form']
⇄concentration => string (3) "N/A"
$value[3]['_source']['concentration']
⇄⧉storage_stability => string (392) "May be stored at 4 degree C for short-term only. For long-term storage and t...
$value[3]['_source']['storage_stability']
May be stored at 4 degree C for short-term only. For long-term storage and to avoid repeated freezing and thawing, add sterile 40-50% glycerol, aliquot and store at -20 degree C. Aliquots are stable for at least 12 months at -20 degree C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
⇄⧉app_notes => string (120) "Suitable for use in Flow Cytometry and Immunoprecipitation.<br>Dilution: Flo...
$value[3]['_source']['app_notes']
Suitable for use in Flow Cytometry and Immunoprecipitation.<br>Dilution: Flow Cytometry: 10ul labels 10e6 cells in 100ul
⇄⧉testing_protocols => string (713) "Application Data||Staining of mouse spleen cells with HAMSTER ANTI MOUSE CD2...
$value[3]['_source']['testing_protocols']
Application Data||Staining of mouse spleen cells with HAMSTER ANTI MOUSE CD29: Alexa Fluor® 647||AAA14704_APP6.jpg!!Application Data||Staining of mouse spleen cells with hamster anti mouse CD29: Alexa Fluor® 488||AAA14704_APP5.jpg!!Application Data||Staining of mouse peripheral blood lymphocytes with HAMSTER ANTI MOUSE CD29:FITC||AAA14704_APP4.jpg!!Application Data||Staining of mouse peripheral blood lymphocytes with HAMSTER ANTI MOUSE CD29: LOW ENDOTOXIN||AAA14704_APP3.jpg!!Application Data||Staining of mouse peripheral blood lymphocytes with HAMSTER ANTI MOUSE CD29||AAA14704_APP2.jpg!!Application Data||Staining of mouse peripheral blood lymphocytes with HAMSTER ANTI MOUSE CD29||AAA14704_APP.jpg
⇄etc_term2 => string (71) "Hybridoma||P3U1 myeloma cells with spleen cells from Armenian hamsters."
$value[3]['_source']['etc_term2']
⇄products_price => string (6) "0.0000"
$value[3]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[3]['_source']['products_weight']
⇄products_status => boolean true
$value[3]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[3]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "600"
$value[3]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[3]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[3]['_source']['language_id']
⇄products_name => string (15) "Integrin, beta1"
$value[3]['_source']['products_name']
⇄⧉products_name_oem => string (214) "Integrin, beta1 (CD29, Very Late Antigen, VLAb1, Platelet gplla, ITGB1, Fibr...
$value[3]['_source']['products_name_oem']
Integrin, beta1 (CD29, Very Late Antigen, VLAb1, Platelet gplla, ITGB1, Fibrinogen Receptor beta Subunit, FNRB, Integrin VLA4 Subunit beta, MDF2, MSK12, Very Late Activation Protein beta Polypeptide, VLAB, VLAbeta)
⇄⧉products_name_syn => string (220) "Anti -Integrin, beta1 (CD29, Very Late Antigen, VLAb1, Platelet gplla, ITGB1...
$value[3]['_source']['products_name_syn']
Anti -Integrin, beta1 (CD29, Very Late Antigen, VLAb1, Platelet gplla, ITGB1, Fibrinogen Receptor beta Subunit, FNRB, Integrin VLA4 Subunit beta, MDF2, MSK12, Very Late Activation Protein beta Polypeptide, VLAB, VLAbeta)
⇄products_gene_name => string (3) "N/A"
$value[3]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[3]['_source']['products_gene_name_syn']
⇄⧉products_description => string (489) "The integrin beta 1 subunit (CD29), is a 110KD cell surface glycoprotein tha...
$value[3]['_source']['products_description']
The integrin beta 1 subunit (CD29), is a 110KD cell surface glycoprotein that is widely expressed by a variety of cells including all leukocytes. CD29 forms non-covalent bonds with the integrin alpha subunits, including CD51 and CD49a-f, to form heterodimers. The ligands for these heterodimers include collagen, fibronectin, laminin and vascular adhesion molecule-1. In the immune system beta 1 integrins play an important role in cell adhesion, migration, activation and differentiation.
⇄products_references => string (3) "N/A"
$value[3]['_source']['products_references']
⇄⧉products_related_diseases => string (210) "Neoplasms||19!!Carcinoma||6!!Nervous System Diseases||5!!Inflammation||4!!Di...
$value[3]['_source']['products_related_diseases']
Neoplasms||19!!Carcinoma||6!!Nervous System Diseases||5!!Inflammation||4!!Disease Models, Animal||4!!Neoplasm Metastasis||4!!Neoplasm Invasiveness||4!!Kidney Diseases||3!!Fibrosis||3!!Cardiovascular Diseases||3
⇄products_categories => string (27) "Antibodies; Abs to Integrin"
⇄⧉search_terms => string (928) "aaa14704 hamster mouse rat monoclonal igg 10b1279 affinity purified by prote...
$value[3]['_source']['search_terms']
aaa14704 hamster mouse rat monoclonal igg 10b1279 affinity purified by protein g chromatography supplied as a liquid in pbs ph 7.4 0.09 sodium azide recognizes the murine integrin beta 1 subunit inhibits mediated adhesion species crossreactivity immunoprecipitation ip flow cytometry fc facs suitable for use and dilution 10ul labels 10e6 cells 100ul testing data staining of peripheral blood lymphocytes with anti cd29 aaa14704_td aaa14704_td2 low endotoxin aaa14704_td3 cd29:fitc aaa14704_td4 spleen alexa fluor® 488 aaa14704_td5 647 aaa14704_td6 antibody beta1 very late antigen vlab1 platelet gplla itgb1 fibrinogen receptor fnrb vla4 mdf2 msk12 activation polypeptide vlab vlabeta fibronectin includes gpiia vla otthump00000019420 4 5,325 da q5t3e4_human 55959577 p05556 q5t3e4 q5t3e5 q5t3e6 antibodies abs to immunogen hybridoma p3u1 myeloma from armenian hamsters ph7.4 fluor®488 aaa14704_td5647 otthump000000194204
Recognizes the murine integrin beta 1 subunit. Inhibits beta 1 integrin mediated adhesion. Species Crossreactivity: rat.
⇄purity => string (67) "Affinity Purified<br>Purified by Protein G affinity chromatography."
$value[4]['_source']['purity']
⇄⧉form => string (112) "Supplied as a liquid in PBS, pH 7.4, 1% BSA, 0.09% sodium azide. Labeled wit...
$value[4]['_source']['form']
Supplied as a liquid in PBS, pH 7.4, 1% BSA, 0.09% sodium azide. Labeled with fluorescein isothiocyanate (FITC).
⇄concentration => string (3) "N/A"
$value[4]['_source']['concentration']
⇄⧉storage_stability => string (432) "May be stored at 4 degree C for short-term only. For long-term storage and t...
$value[4]['_source']['storage_stability']
May be stored at 4 degree C for short-term only. For long-term storage and to avoid repeated freezing and thawing, add sterile 40-50% glycerol, aliquot and store at -20 degree C. Aliquots are stable for at least 12 months at -20 degree C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. FITC conjugates are sensitive to light.
⇄⧉app_notes => string (102) "Suitable for use in Flow Cytometry.<br>Dilution: Flow Cytometry: Neat; 10ul ...
$value[4]['_source']['app_notes']
Suitable for use in Flow Cytometry.<br>Dilution: Flow Cytometry: Neat; 10ul labels 10e6 cells in 100ul
⇄⧉testing_protocols => string (713) "Application Data||Staining of mouse spleen cells with HAMSTER ANTI MOUSE CD2...
$value[4]['_source']['testing_protocols']
Application Data||Staining of mouse spleen cells with HAMSTER ANTI MOUSE CD29: Alexa Fluor® 647||AAA14701_APP6.jpg!!Application Data||Staining of mouse spleen cells with hamster anti mouse CD29: Alexa Fluor® 488||AAA14701_APP5.jpg!!Application Data||Staining of mouse peripheral blood lymphocytes with HAMSTER ANTI MOUSE CD29:FITC||AAA14701_APP4.jpg!!Application Data||Staining of mouse peripheral blood lymphocytes with HAMSTER ANTI MOUSE CD29: LOW ENDOTOXIN||AAA14701_APP3.jpg!!Application Data||Staining of mouse peripheral blood lymphocytes with HAMSTER ANTI MOUSE CD29||AAA14701_APP2.jpg!!Application Data||Staining of mouse peripheral blood lymphocytes with HAMSTER ANTI MOUSE CD29||AAA14701_APP.jpg
⇄⧉products_name_oem => string (221) "Integrin, beta1 (CD29, Very Late Antigen, VLAb1, Platelet gplla, ITGB1, Fibr...
$value[4]['_source']['products_name_oem']
Integrin, beta1 (CD29, Very Late Antigen, VLAb1, Platelet gplla, ITGB1, Fibrinogen Receptor beta Subunit, FNRB, Integrin VLA4 Subunit beta, MDF2, MSK12, Very Late Activation Protein beta Polypeptide, VLAB, VLAbeta) (FITC)
⇄⧉products_name_syn => string (227) "Anti -Integrin, beta1 (CD29, Very Late Antigen, VLAb1, Platelet gplla, ITGB1...
$value[4]['_source']['products_name_syn']
Anti -Integrin, beta1 (CD29, Very Late Antigen, VLAb1, Platelet gplla, ITGB1, Fibrinogen Receptor beta Subunit, FNRB, Integrin VLA4 Subunit beta, MDF2, MSK12, Very Late Activation Protein beta Polypeptide, VLAB, VLAbeta) (FITC)
⇄products_gene_name => string (3) "N/A"
$value[4]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[4]['_source']['products_gene_name_syn']
⇄⧉products_description => string (488) "The integrin beta 1 subunit (CD29) is a 110KD cell surface glycoprotein that...
$value[4]['_source']['products_description']
The integrin beta 1 subunit (CD29) is a 110KD cell surface glycoprotein that is widely expressed by a variety of cells including all leukocytes. CD29 forms non-covalent bonds with the integrin alpha subunits, including CD51 and CD49a-f, to form heterodimers. The ligands for these heterodimers include collagen, fibronectin, laminin and vascular adhesion molecule-1. In the immune system beta 1 integrins play an important role in cell adhesion, migration, activation and differentiation.
⇄products_references => string (3) "N/A"
$value[4]['_source']['products_references']
⇄⧉products_related_diseases => string (210) "Neoplasms||19!!Carcinoma||6!!Nervous System Diseases||5!!Inflammation||4!!Di...
$value[4]['_source']['products_related_diseases']
Neoplasms||19!!Carcinoma||6!!Nervous System Diseases||5!!Inflammation||4!!Disease Models, Animal||4!!Neoplasm Metastasis||4!!Neoplasm Invasiveness||4!!Kidney Diseases||3!!Fibrosis||3!!Cardiovascular Diseases||3
⇄products_categories => string (27) "Antibodies; Abs to Integrin"
⇄⧉etc_term1 => string (158) "Samples||Serum, Plasma, Tissue Homogenate, Feces, Urine and Body Fluids!!Ass...
$value[5]['_source']['etc_term1']
Samples||Serum, Plasma, Tissue Homogenate, Feces, Urine and Body Fluids!!Assay Type||Sandwich!!Detection Range||2.5 ng/ml - 80 ng/ml.!!Sensitivity||1.0 ng/ml.
⇄⧉etc_term2 => string (972) "Intended Uses||ELISA is a simple and highly sensitive method of analysis tha...
$value[5]['_source']['etc_term2']
Intended Uses||ELISA is a simple and highly sensitive method of analysis that allows for simultaneous and rapid quantification of a large number of samples. The assay is based on the specific recognition of the target compound (analyte/antigen) by antibodies which bind to the compound. The antigen-antibody complex is detected and measured with the aid of an enzyme-labeled antibody or antigen. Upon addition of a non-colored reagent, the enzyme produces a color reaction where the color intensity is directly or inversely proportional to the concentration of the analyte in the sample. This quantitative Sandwich ELISA kit is in tended to determinate P3NP concentrations in Canine serum, plasma, tissue homogenates, feces, urine and body fluids, and it is only for research, not for drug, household, therapeutic applications!!Intra-assay Precision||Intra-assay CV (%) are less than 15%.!!Inter-assay Precision||Inter-assay CV (%) is less than 15%. [CV(%) = SD/mean x100]
⇄products_price => string (6) "0.0000"
$value[5]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[5]['_source']['products_weight']
⇄products_status => boolean true
$value[5]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[5]['_source']['products_tax_class_id']
⇄manufacturers_id => string (1) "1"
$value[5]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[5]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[5]['_source']['language_id']
⇄products_name => string (42) "Procollagen Type III N-Terminal Propeptide"
$value[5]['_source']['products_name']
⇄products_name_oem => string (59) "Canine Procollagen Type III N-Terminal Propeptide ELISA Kit"
$value[5]['_source']['products_name_oem']
⇄products_name_syn => string (3) "N/A"
$value[5]['_source']['products_name_syn']
⇄products_gene_name => string (4) "P3NP"
$value[5]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[5]['_source']['products_gene_name_syn']
⇄⧉products_description => string (782) "<b>Introduction: </b>ELISA is a simple and highly sensitive method of analys...
$value[5]['_source']['products_description']
<b>Introduction: </b>ELISA is a simple and highly sensitive method of analysis that allows for simultaneous and rapid quantification of a large number of samples. The assay is based on the specific recognition of the target compound (analyte/antigen) by antibodies which bind to the compound. The antigen-antibody complex is detected and measured with the aid of an enzyme-labeled antibody or antigen. Upon addition of a non-colored reagent, the enzyme produces a color reaction where the color intensity is directly or inversely proportional to the concentration of the analyte in the sample. This quantitative Sandwich ELISA kit is in tended to determinate P3NP concentrations in Canine serum, plasma, tissue homogenates, feces, urine and body fluids, and it is only for research!
⇄products_references => string (3) "N/A"
$value[5]['_source']['products_references']
⇄products_related_diseases => string (3) "N/A"
$value[5]['_source']['products_related_diseases']
⇄products_categories => string (3) "N/A"
$value[5]['_source']['products_categories']
⇄ncbi_full_name => string (3) "N/A"
$value[5]['_source']['ncbi_full_name']
⇄ncbi_full_name_syn => string (3) "N/A"
$value[5]['_source']['ncbi_full_name_syn']
⇄ncbi_symbol => string (3) "N/A"
$value[5]['_source']['ncbi_symbol']
⇄ncbi_symbol_syn => string (3) "N/A"
$value[5]['_source']['ncbi_symbol_syn']
⇄ncbi_protein_info => string (3) "N/A"
$value[5]['_source']['ncbi_protein_info']
⇄ncbi_chrom_loc => string (3) "N/A"
$value[5]['_source']['ncbi_chrom_loc']
⇄ncbi_gene_id => string (3) "N/A"
$value[5]['_source']['ncbi_gene_id']
⇄ncbi_mol_weight => string (3) "N/A"
$value[5]['_source']['ncbi_mol_weight']
⇄ncbi_pathways => string (3) "N/A"
$value[5]['_source']['ncbi_pathways']
⇄sp_protein_name => string (3) "N/A"
$value[5]['_source']['sp_protein_name']
⇄sp_protein_name_syn => string (3) "N/A"
$value[5]['_source']['sp_protein_name_syn']
⇄sp_gene_name => string (3) "N/A"
$value[5]['_source']['sp_gene_name']
⇄sp_gene_name_syn => string (3) "N/A"
$value[5]['_source']['sp_gene_name_syn']
⇄sp_entry_name => string (3) "N/A"
$value[5]['_source']['sp_entry_name']
⇄sp_mim => string (3) "N/A"
$value[5]['_source']['sp_mim']
⇄sp_interactions => string (3) "N/A"
$value[5]['_source']['sp_interactions']
⇄products_url => string (3) "N/A"
$value[5]['_source']['products_url']
⇄products_viewed => string (1) "0"
$value[5]['_source']['products_viewed']
⇄⧉search_terms => string (966) "aaa10058 canine no significant cross reactivity or interference between p3np...
$value[5]['_source']['search_terms']
aaa10058 canine no significant cross reactivity or interference between p3np and analogues was observed typical testing data standard curve for reference only aaa10058_td elisa kit procollagen type iii n terminal propeptide samples serum plasma tissue homogenate feces urine body fluids assay sandwich detection range 2.5 ng ml 80 sensitivity 1.0 intended uses is a simple highly sensitive method of analysis that allows simultaneous rapid quantification large number the based on specific recognition target compound analyte antigen by antibodies which bind to antibody complex detected measured with aid an enzyme labeled upon addition non colored reagent produces color reaction where intensity directly inversely proportional concentration in sample this quantitative tended determinate concentrations homogenates it research not drug household therapeutic applications intra precision cv are less than 15 inter = sd mean x100 range2.5 ml80 sensitivity1.0 than15
⇄⧉specificity => string (171) "This assay has high sensitivity and excellent specificity for detection of I...
$value[6]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of ITGB1. No significant cross-reactivity or interference between ITGB1 and analogues was observed.
⇄purity => string (3) "N/A"
$value[6]['_source']['purity']
⇄form => string (3) "N/A"
$value[6]['_source']['form']
⇄concentration => string (3) "N/A"
$value[6]['_source']['concentration']
⇄⧉storage_stability => string (156) "Store entire kit at 2-8C for short-term. For longer-term, please store the m...
$value[6]['_source']['storage_stability']
Store entire kit at 2-8C for short-term. For longer-term, please store the microplate & standard at -20C, while the remaining reagents can be stored at 2-8C
⇄⧉products_description => string (825) "Principle of the Assay: This kit was based on sandwich enzyme-linked immune-...
$value[6]['_source']['products_description']
Principle of the Assay: This kit was based on sandwich enzyme-linked immune-sorbent assay technology. Capture antibody was pre-coated onto 96-well plates. And the biotin conjugated antibody was used as detection antibodies. The standards, test samples and biotin conjugated detection antibody were added to the wells subsequently, and washed with wash buffer. HRP-Streptavidin was added and unbound conjugates were washed away with wash buffer. TMB substrates were used to visualize HRP enzymatic reaction. TMB was catalyzed by HRP to produce a blue color product that changed into yellow after adding acidic stop solution. The density of yellow is proportional to the target amount of sample captured in plate. Read the O.D. absorbance at 450nm in a microplate reader, and then the concentration of target can be calculated.
⇄⧉search_terms => string (737) "aaa17373 human this assay has high sensitivity and excellent specificity for...
$value[6]['_source']['search_terms']
aaa17373 human this assay has high sensitivity and excellent specificity for detection of itgb1 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa17373_sc elisa kit integrin beta 1 cd29 antigen fibronectin receptor subunit fnrbvlab gpiia vla 4 polypeptide includesmdf2 msk12 mdf2 very late activation protein isoform 1d fnrb vlab 88,884 da glycoprotein iia cd_antigen itb1_human 19743819 np_391988.1 p05556 nm_033668.2 p78466 p78467 q13089 q13090 q13091 q13212 a8k6n2 d3drx9 d3dry3 d3dry4 d3dry5 135630 samples serum plasma tissue homogenates other biological fluids type quantitative sandwich range 15.625 1000pg ml 9.375pg intra precision cv beta1 vla4
⇄⧉etc_term1 => string (158) "Samples||Serum, Plasma, Tissue Homogenate, Feces, Urine and Body Fluids!!Ass...
$value[7]['_source']['etc_term1']
Samples||Serum, Plasma, Tissue Homogenate, Feces, Urine and Body Fluids!!Assay Type||Sandwich!!Detection Range||25 ng/ml - 200 ng/ml.!!Sensitivity||1.0 ng/ml.
⇄⧉etc_term2 => string (974) "Intended Uses||ELISA is a simple and highly sensitive method of analysis tha...
$value[7]['_source']['etc_term2']
Intended Uses||ELISA is a simple and highly sensitive method of analysis that allows for simultaneous and rapid quantification of a large number of samples. The assay is based on the specific recognition of the target compound (analyte/antigen) by antibodies which bind to the compound. The antigen-antibody complex is detected and measured with the aid of an enzyme-labeled antibody or antigen. Upon addition of a non-colored reagent, the enzyme produces a color reaction where the color intensity is directly or inversely proportional to the concentration of the analyte in the sample. This quantitative Sandwich ELISA kit is intended to determinate ADAMTS4 concentrations in Rabbit serum, plasma, tissue homogenates, feces, urine and body fluids, and it is only for research, not for drug, household, therapeutic applications!!Intra-assay Precision||Intra-assay CV (%) are less than 15%.!!Inter-assay Precision||Inter-assay CV (%) is less than 15%. [CV(%) = SD/mean x100]
⇄products_price => string (6) "0.0000"
$value[7]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[7]['_source']['products_weight']
⇄products_status => boolean true
$value[7]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[7]['_source']['products_tax_class_id']
⇄manufacturers_id => string (1) "1"
$value[7]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[7]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[7]['_source']['language_id']
⇄products_name => string (75) "A Disintegrin Like and Metalloproteinase With Thrombospondin Type 1 Motif 4"
$value[7]['_source']['products_name']
⇄⧉products_name_oem => string (92) "Rabbit A Disintegrin Like and Metalloproteinase With Thrombospondin Type 1 M...
$value[7]['_source']['products_name_oem']
Rabbit A Disintegrin Like and Metalloproteinase With Thrombospondin Type 1 Motif 4 ELISA Kit
⇄products_name_syn => string (3) "N/A"
$value[7]['_source']['products_name_syn']
⇄products_gene_name => string (7) "ADAMTS4"
$value[7]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[7]['_source']['products_gene_name_syn']
⇄⧉products_description => string (784) "<b>Introduction: </b>ELISA is a simple and highly sensitive method of analys...
$value[7]['_source']['products_description']
<b>Introduction: </b>ELISA is a simple and highly sensitive method of analysis that allows for simultaneous and rapid quantification of a large number of samples. The assay is based on the specific recognition of the target compound (analyte/antigen) by antibodies which bind to the compound. The antigen-antibody complex is detected and measured with the aid of an enzyme-labeled antibody or antigen. Upon addition of a non-colored reagent, the enzyme produces a color reaction where the color intensity is directly or inversely proportional to the concentration of the analyte in the sample. This quantitative Sandwich ELISA kit is intended to determinate ADAMTS4 concentrations in Rabbit serum, plasma, tissue homogenates, feces, urine and body fluids, and it is only for research!
⇄⧉ncbi_protein_info => string (194) "A disintegrin and metalloproteinase with thrombospondin motifs 4; ADAM-TS4; ...
$value[7]['_source']['ncbi_protein_info']
A disintegrin and metalloproteinase with thrombospondin motifs 4; ADAM-TS4; ADAM-TS 4; aggrecanase-1; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 4
⇄⧉search_terms => string (1214) "aaa10094 rabbit no significant cross reactivity or interference between adam...
$value[7]['_source']['search_terms']
aaa10094 rabbit no significant cross reactivity or interference between adamts4 and analogues was observed typical testing data standard curve for reference only aaa10094_td elisa kit a disintegrin like metalloproteinase with thrombospondin type 1 motif 4 motifs preproprotein adam metallopeptidase admp adamts 2 ts4 ts aggrecanase metalloprotease reprolysin 90,197 da kiaa0688 ats4_human 157427675 np_005090.3 o75173 nm_005099.4 q5vtw2 q6p4q8 q6uwa8 q9un83 603876 samples serum plasma tissue homogenate feces urine body fluids assay sandwich detection range 25 ng ml 200 sensitivity 1.0 intended uses is simple highly sensitive method of analysis that allows simultaneous rapid quantification large number the based on specific recognition target compound analyte antigen by antibodies which bind to antibody complex detected measured aid an enzyme labeled upon addition non colored reagent produces color reaction where intensity directly inversely proportional concentration in sample this quantitative determinate concentrations homogenates it research not drug household therapeutic applications intra precision cv are less than 15 inter = sd mean x100 type1 motif4 adamts2 range25 ml200 sensitivity1.0 than15
⇄⧉products_description => string (684) "Intended Uses: This CD41 ELISA kit is intended Laboratory for Research use o...
$value[8]['_source']['products_description']
Intended Uses: This CD41 ELISA kit is intended Laboratory for Research use only and is not for use in diagnostic or therapeutic procedures. The Stop Solution changes the color from blue to yellow and the intensity of the color is measured at 450 nm using a spectrophotometer. In order to measure the concentration of CD41 in the sample, this CD41 ELISA Kit includes a set of calibration standards. The calibration standards are assayed at the same time as the samples and allow the operator to produce a standard curve of Optical Density versus CD41 concentration. The concentration of CD41 in the samples is then determined by comparing the O.D. of the samples to the standard curve.
⇄products_references => string (3) "N/A"
$value[8]['_source']['products_references']
⇄⧉products_related_diseases => string (228) "Blood Coagulation Disorders||26!!Nervous System Diseases||3!!Atherosclerosis...
$value[8]['_source']['products_related_diseases']
Blood Coagulation Disorders||26!!Nervous System Diseases||3!!Atherosclerosis||2!!Inflammation||2!!Kidney Diseases||1!!Diabetes Mellitus, Type 2||1!!Myelodysplastic Syndromes||1!!Coronary Restenosis||1!!Recurrence||1!!Leukemia||1
⇄⧉search_terms => string (326) "aaa23682 human typical testing data standard curve for reference only aaa236...
$value[8]['_source']['search_terms']
aaa23682 human typical testing data standard curve for reference only aaa23682_sc elisa kit cd41 integrin alpha iib 2b itga2b cd41b gpiib ai172977 alphaiib gpalpha platelet membrane glycoprotein ita2b_mouse 159110663 np_034705.2 q9qum0 sensitivity 0.1 ng ml intra assay precision cv less than 15 inter is sensitivity0.1 than15
⇄⧉products_description => string (635) "Intended Uses: This HEV-AG ELISA kit is intended Laboratory for Research use...
$value[9]['_source']['products_description']
Intended Uses: This HEV-AG ELISA kit is intended Laboratory for Research use only. The Stop Solution changes the color from blue to yellow and the intensity of the color is measured at 450 nm using a spectrophotometer. In order to measure the concentration of HEV-AG in the sample, this HEV-AG ELISA Kit includes a set of calibration standards. The calibration standards are assayed at the same time as the samples and allow the operator to produce a standard curve of Optical Density versus HEV-AG concentration. The concentration of HEV-AG in the samples is then determined by comparing the O.D. of the samples to the standard curve.
⇄products_references => string (3) "N/A"
$value[9]['_source']['products_references']
⇄products_related_diseases => string (3) "N/A"
$value[9]['_source']['products_related_diseases']
⇄products_categories => string (3) "N/A"
$value[9]['_source']['products_categories']
⇄ncbi_full_name => string (3) "N/A"
$value[9]['_source']['ncbi_full_name']
⇄ncbi_full_name_syn => string (3) "N/A"
$value[9]['_source']['ncbi_full_name_syn']
⇄ncbi_symbol => string (3) "N/A"
$value[9]['_source']['ncbi_symbol']
⇄ncbi_symbol_syn => string (3) "N/A"
$value[9]['_source']['ncbi_symbol_syn']
⇄ncbi_protein_info => string (3) "N/A"
$value[9]['_source']['ncbi_protein_info']
⇄ncbi_chrom_loc => string (3) "N/A"
$value[9]['_source']['ncbi_chrom_loc']
⇄ncbi_gene_id => string (3) "N/A"
$value[9]['_source']['ncbi_gene_id']
⇄ncbi_mol_weight => string (3) "N/A"
$value[9]['_source']['ncbi_mol_weight']
⇄ncbi_pathways => string (3) "N/A"
$value[9]['_source']['ncbi_pathways']
⇄sp_protein_name => string (3) "N/A"
$value[9]['_source']['sp_protein_name']
⇄sp_protein_name_syn => string (3) "N/A"
$value[9]['_source']['sp_protein_name_syn']
⇄sp_gene_name => string (3) "N/A"
$value[9]['_source']['sp_gene_name']
⇄sp_gene_name_syn => string (3) "N/A"
$value[9]['_source']['sp_gene_name_syn']
⇄sp_entry_name => string (3) "N/A"
$value[9]['_source']['sp_entry_name']
⇄sp_mim => string (3) "N/A"
$value[9]['_source']['sp_mim']
⇄sp_interactions => string (3) "N/A"
$value[9]['_source']['sp_interactions']
⇄products_url => string (3) "N/A"
$value[9]['_source']['products_url']
⇄products_viewed => string (1) "0"
$value[9]['_source']['products_viewed']
⇄⧉search_terms => string (215) "aaa23644 human typical testing data standard curve for reference only aaa236...
$value[9]['_source']['search_terms']
aaa23644 human typical testing data standard curve for reference only aaa23644_sc elisa kit hepatitis e virus antigen hev ag sensitivity 0.1 ng ml intra assay precision cv is less than 15 inter sensitivity0.1 than15
⇄⧉products_description => string (679) "Intended Uses: This PRA ELISA kit is intended Laboratory for Research use on...
$value[10]['_source']['products_description']
Intended Uses: This PRA ELISA kit is intended Laboratory for Research use only and is not for use in diagnostic or therapeutic procedures. The Stop Solution changes the color from blue to yellow and the intensity of the color is measured at 450 nm using a spectrophotometer. In order to measure the concentration of PRA in the sample, this PRA ELISA Kit includes a set of calibration standards. The calibration standards are assayed at the same time as the samples and allow the operator to produce a standard curve of Optical Density versus PRA concentration. The concentration of PRA in the samples is then determined by comparing the O.D. of the samples to the standard curve.
⇄⧉search_terms => string (206) "aaa23758 rat typical testing data standard curve for reference only aaa23758...
$value[10]['_source']['search_terms']
aaa23758 rat typical testing data standard curve for reference only aaa23758_sc elisa kit plasma renin activity pra sensitivity 0.1 ng ml intra assay precision cv less than 15 inter is sensitivity0.1 than15
⇄⧉products_description => string (521) "Principle of the Assay: The kit uses a sandwich enzyme-linked immunosorbent ...
$value[11]['_source']['products_description']
Principle of the Assay: The kit uses a sandwich enzyme-linked immunosorbent assay (ELISA) to qualitatively analyze Galactomannan Antigen (AGMAg) in serum and plasma samples. This kit is in vitro research use only! Not for therapeutic or diagnostic applications!<br><br>Intended Uses: The kit uses a sandwich enzyme-linked immunosorbent assay (ELISA) to qualitatively analyze Galactomannan Antigen (AGMAg) in serum and plasma samples. This kit is in vitro research use only! Not for therapeutic or diagnostic applications!
aaa29625 general elisa kit galactomannan antigen agmag samples serum plasma assay type qualitative sandwich intra precision cv are less than 15 inter ? than15
⇄⧉products_description => string (784) "Intended Uses: This CITRULLINATED HISTONE H3 ELISA kit is intended Laborator...
$value[12]['_source']['products_description']
Intended Uses: This CITRULLINATED HISTONE H3 ELISA kit is intended Laboratory for Research use only and is not for use in diagnostic or therapeutic procedures. The Stop Solution changes the color from blue to yellow and the intensity of the color is measured at 450 nm using a spectrophotometer. In order to measure the concentration of CITRULLINATED HISTONE H3 in the sample, this CITRULLINATED HISTONE H3 ELISA Kit includes a set of calibration standards. The calibration standards are assayed at the same time as the samples and allow the operator to produce a standard curve of Optical Density versus CITRULLINATED HISTONE H3 concentration. The concentration of CITRULLINATED HISTONE H3 in the samples is then determined by comparing the O.D. of the samples to the standard curve.
⇄⧉search_terms => string (207) "aaa23710 human typical testing data standard curve for reference only aaa237...
$value[12]['_source']['search_terms']
aaa23710 human typical testing data standard curve for reference only aaa23710_sc elisa kit citrullinated histone h3 sensitivity 0.1 ng ml intra assay precision cv less than 15 inter is sensitivity0.1 than15
⇄⧉products_description => string (699) "Intended Uses: This AFT-HSA ELISA kit is intended Laboratory for Research us...
$value[13]['_source']['products_description']
Intended Uses: This AFT-HSA ELISA kit is intended Laboratory for Research use only and is not for use in diagnostic or therapeutic procedures. The Stop Solution changes the color from blue to yellow and the intensity of the color is measured at 450 nm using a spectrophotometer. In order to measure the concentration of AFT-HSA in the sample, this AFT-HSA ELISA Kit includes a set of calibration standards. The calibration standards are assayed at the same time as the samples and allow the operator to produce a standard curve of Optical Density versus AFT-HSA concentration. The concentration of AFT-HSA in the samples is then determined by comparing the O.D. of the samples to the standard curve.
⇄⧉search_terms => string (215) "aaa23678 human typical testing data standard curve for reference only aaa236...
$value[13]['_source']['search_terms']
aaa23678 human typical testing data standard curve for reference only aaa23678_sc elisa kit aflatoxin albumin adduct aft hsa sensitivity 0.1 ng ml intra assay precision cv less than 15 inter is sensitivity0.1 than15
⇄⧉products_description => string (689) "Intended Uses: This HBSAB ELISA kit is intended Laboratory for Research use ...
$value[14]['_source']['products_description']
Intended Uses: This HBSAB ELISA kit is intended Laboratory for Research use only and is not for use in diagnostic or therapeutic procedures. The Stop Solution changes the color from blue to yellow and the intensity of the color is measured at 450 nm using a spectrophotometer. In order to measure the concentration of HBSAB in the sample, this HBSAB ELISA Kit includes a set of calibration standards. The calibration standards are assayed at the same time as the samples and allow the operator to produce a standard curve of Optical Density versus HBSAB concentration. The concentration of HBSAB in the samples is then determined by comparing the O.D. of the samples to the standard curve.
⇄⧉search_terms => string (228) "aaa23634 human typical testing data standard curve for reference only aaa236...
$value[14]['_source']['search_terms']
aaa23634 human typical testing data standard curve for reference only aaa23634_sc elisa kit anti hepatitis b virus surface hbsab antibody sensitivity 0.1 ng ml intra assay precision cv less than 15 inter is sensitivity0.1 than15
⇄⧉etc_term2 => string (115) "Intra-assay Precision|| Intra-assay CV are less than 15%.!!Inter-assay Preci...
$value[15]['_source']['etc_term2']
Intra-assay Precision|| Intra-assay CV are less than 15%.!!Inter-assay Precision||Inter-assay CV are less than 15%.
⇄products_price => string (6) "0.0000"
$value[15]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[15]['_source']['products_weight']
⇄products_status => boolean true
$value[15]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[15]['_source']['products_tax_class_id']
⇄manufacturers_id => string (4) "3800"
$value[15]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[15]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[15]['_source']['language_id']
⇄products_name => string (47) "N-Terminal Propeptide Of Type I Collagen (PINP)"
$value[15]['_source']['products_name']
⇄products_name_oem => string (63) "Mouse N-Terminal Propeptide Of Type I Collagen (PINP) ELISA Kit"
$value[15]['_source']['products_name_oem']
⇄products_name_syn => string (3) "N/A"
$value[15]['_source']['products_name_syn']
⇄products_gene_name => string (4) "PINP"
$value[15]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[15]['_source']['products_gene_name_syn']
⇄⧉products_description => string (684) "Intended Uses: This PINP ELISA kit is intended Laboratory for Research use o...
$value[15]['_source']['products_description']
Intended Uses: This PINP ELISA kit is intended Laboratory for Research use only and is not for use in diagnostic or therapeutic procedures. The Stop Solution changes the color from blue to yellow and the intensity of the color is measured at 450 nm using a spectrophotometer. In order to measure the concentration of PINP in the sample, this PINP ELISA Kit includes a set of calibration standards. The calibration standards are assayed at the same time as the samples and allow the operator to produce a standard curve of Optical Density versus PINP concentration. The concentration of PINP in the samples is then determined by comparing the O.D. of the samples to the standard curve.
⇄⧉search_terms => string (228) "aaa23718 mouse typical testing data standard curve for reference only aaa237...
$value[15]['_source']['search_terms']
aaa23718 mouse typical testing data standard curve for reference only aaa23718_sc elisa kit n terminal propeptide of type i collagen pinp sensitivity 0.1 ng ml intra assay precision cv is less than 15 inter sensitivity0.1 than15
⇄⧉products_description => string (898) "Intended Uses: This Progesterone competitive ELISA kit is intended for Labor...
$value[16]['_source']['products_description']
Intended Uses: This Progesterone competitive ELISA kit is intended for Laboratory Research use only and is not for use in diagnostic or therapeutic procedures. Add sample and Progesterone standards in the plate wells where Progesterone antibodies have been coated. Then add HRP-labeled mouse Progesterone antigen. The unreacted component will be removed after incubating and washing, and the solid-phase antibody-enzyme-labeled antigen immune complex on the solid surface of the microplate will remain. After adding Chromogen Solution A and Chromogen Solution B, the immune complex will change to blue by HRP catalyzing. It will change to yellow at the end when the adding stop solution works. Measure the absorbance (OD value) at 450 nm using a microtiter plate reader. The concentration of Progesterone in the samples is then determined by comparing the O.D. of the samples to the standard curve.
⇄⧉search_terms => string (197) "aaa23726 mouse typical testing data standard curve for reference only aaa237...
$value[16]['_source']['search_terms']
aaa23726 mouse typical testing data standard curve for reference only aaa23726_sc elisa kit progesterone p sensitivity 0.1 ng ml intra assay precision cv is less than 15 inter sensitivity0.1 than15
Assay Type||Quantitative Sandwich!!Samples||Serum, plasma, cell culture supernates, Ascites, tissue homogenates or other biological fluids!!Detection Range||0.5-150ng/mL!!Sensitivity||0.34ng/mL
⇄⧉etc_term2 => string (403) "Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Thr...
$value[17]['_source']['etc_term2']
Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Three samples of known concentration were tested on one plate to assess intra-assay precision. Intra-Assay: CV<8%!!Inter-assay Precision||Inter-Assay Precision (Precision between assays) Three samples of known concentration were tested in separate assays to assess inter-assay precision. CV(%) = SD/mean x 100. Inter-Assay: CV<10%
⇄⧉products_description => string (865) "Principle of the Assay: This kit is an Enzyme-Linked Immunosorbent Assay (EL...
$value[17]['_source']['products_description']
Principle of the Assay: This kit is an Enzyme-Linked Immunosorbent Assay (ELISA). The plate has been pre-coated with Canine DA antibody. DA present in the sample is added and binds to antibodies coated on the wells. And then biotinylated Canine DA Antibody is added and binds to DA in the sample. Then Streptavidin-HRP is added and binds to the Biotinylated DA antibody. After incubation unbound Streptavidin-HRP is washed away during a washing step. Substrate solution is then added and color develops in proportion to the amount of Canine DA. The reaction is terminated by addition of acidic stop solution and absorbance is measured at 450 nm.<br><br>Intended Uses: This sandwich kit is for the accurate quantitative detection of Canine Dopamine (also known as DA) in serum, plasma, cell culture supernates, Ascites, tissue homogenates or other biological fluids.
⇄⧉search_terms => string (448) "aaa19032 canine typical testing data standard curve for reference only aaa19...
$value[17]['_source']['search_terms']
aaa19032 canine typical testing data standard curve for reference only aaa19032_sc elisa kit dopamine samples serum plasma cell culture supernates ascites tissue homogenates or other biological fluids assay type quantitative sandwich detection range 0.5 150ng ml sensitivity 0.34ng intra precision within an three of known concentration were tested on one plate to assess cv<8 inter between assays in separate cv = sd mean x 100 cv<10 range0.5 x100
⇄⧉products_description => string (615) "Intended Uses: This SM ELISA kit is intended Laboratory for Research use onl...
$value[18]['_source']['products_description']
Intended Uses: This SM ELISA kit is intended Laboratory for Research use only. The Stop Solution changes the color from blue to yellow and the intensity of the color is measured at 450 nm using a spectrophotometer. In order to measure the concentration of SM in the sample, this SM ELISA Kit includes a set of calibration standards. The calibration standards are assayed at the same time as the samples and allow the operator to produce a standard curve of Optical Density versus SM concentration. The concentration of SM in the samples is then determined by comparing the O.D. of the samples to the standard curve.
⇄⧉search_terms => string (199) "aaa23658 human typical testing data standard curve for reference only aaa236...
$value[18]['_source']['search_terms']
aaa23658 human typical testing data standard curve for reference only aaa23658_sc elisa kit sphingomyelin sm sensitivity 0.1 ng ml intra assay precision cv is less than 15 inter sensitivity0.1 than15
⇄⧉products_description => string (557) "Principle of the Assay: The kit uses a indirect enzyme-linked immunosorbent ...
$value[19]['_source']['products_description']
Principle of the Assay: The kit uses a indirect enzyme-linked immunosorbent assay (ELISA) to qualitatively analyze Human Papillomavirus Antibody IgG (PV-IgG) in Human serum or plasma samples. This kit is in vitro research use only! Not for therapeutic or diagnostic applications!<br><br>Intended Uses: The kit uses a indirect enzyme-linked immunosorbent assay (ELISA) to qualitatively analyze Human Papillomavirus Antibody IgG (PV-IgG) in Human serum or plasma samples. This kit is in vitro research use only! Not for therapeutic or diagnostic applications!
